SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002726 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002726
Domain Number 1 Region: 21-330
Classification Level Classification E-value
Superfamily RNI-like 6.84e-34
Family 28-residue LRR 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000002726
Domain Number - Region: 439-494
Classification Level Classification E-value
Superfamily Coiled-coil dimerization domain from cortexillin I 0.00471
Family Coiled-coil dimerization domain from cortexillin I 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002726   Gene: ENSOGAG00000003043   Transcript: ENSOGAT00000003046
Sequence length 721
Comment pep:known_by_projection scaffold:OtoGar3:GL873525.1:36279271:36311333:1 gene:ENSOGAG00000003043 transcript:ENSOGAT00000003046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFDSVKLRRDNATDFFSHYEYLCALQDSVPLPAVRACLREGVLDFNADRLRMVDWAPLLS
TLKINKDLPWISIKSFFQPWLGDVGSDINKVCRSRVPAIRFKDVTFQLCKALKGCLSVSS
MLRNLELNGLVLRERDLTVLTKGLNKSASLVHLSLANCPIGDGGLEIICQGIKSSVPLKT
VNFSGCNLTWQGADHMAKILKYQTIRRHEETWAESLRYRRPDLDCMAGLRRITLNCNTLI
GDLGACAFADCLSEDLWLRALDLQQCGLTNEGAKALLKALETNRTLVILDVRKNPLIDHS
LMKAVIKKVLQNGRSAKSEYQWITSPSVKESSKTARQKKKTIILGSGRKGKATIRIGLAT
KKPISNGRKHSLGNEQDTPISLPPGVSGFLPWRTAERAKRKRGFPSIKTRDIDNQFKQPG
FPVTVTVESPSSSEIEEVDDSSESVHEVPEKTSLEQGVLQEKLDECLKQLKEERVIRLKA
DKRVSELEHENAQLRNINFSLSEALHAHSLTSMILDDEGVLGSIENSFQKFHAFLDLLKD
AGLGQLATMAGIDQSDFHLLGPPQMNSTVSSLPREEKKALEEEKPEAKQNAIGQMQNIQV
SICMQSAYNEGTLMKFQKITSDARIPLPLDSFPVPVSTQEPLVTSTDNVGVPATEQQQES
LEGFIARTHSPLADVISGTGSQRVEEEVSVNSKSSSEKRTKTGEHTKKHSAKKQPGKDLH
S
Download sequence
Identical sequences H0WM06
ENSOGAP00000002726 ENSOGAP00000002726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]