SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002793 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002793
Domain Number 1 Region: 15-192
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 3.53e-60
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0000000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002793   Gene: ENSOGAG00000003119   Transcript: ENSOGAT00000003122
Sequence length 204
Comment pep:known_by_projection scaffold:OtoGar3:GL873530.1:27022891:27046654:1 gene:ENSOGAG00000003119 transcript:ENSOGAT00000003122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPKTSCSTDALLMERKFHILVGVTGSVAALKLPLLVSRLLDIPGLEVAVVTTERAKHFY
SPQDIPVTLYSDADEWEMWKHRSDPVLHIDLRRWADLMLVAPLDANTLGKVASGICDNLL
TCVIRAWDRSKPLFFCPAMNTAMWEHPITVQQVGQLKAFGYTEIPCVAKKLVCGDEGLGA
MAEVETIVEKVKEVLSQQVGFKHS
Download sequence
Identical sequences H0WM54
XP_003784722.1.62490 ENSOGAP00000002793 ENSOGAP00000002793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]