SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002807 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002807
Domain Number 1 Region: 68-133
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000209
Family F-box domain 0.003
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000002807
Domain Number - Region: 223-336,438-470
Classification Level Classification E-value
Superfamily L domain-like 0.00204
Family Internalin LRR domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002807   Gene: ENSOGAG00000003137   Transcript: ENSOGAT00000003139
Sequence length 554
Comment pep:known_by_projection scaffold:OtoGar3:GL873571.1:56358:92510:1 gene:ENSOGAG00000003137 transcript:ENSOGAT00000003139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFLSLPQPRPPGARTRAGAARVARWRRQRLRXXXXXXXXXXXXXXXGAGSRRRGRMAL
CGQAAGAASLPSELIVHIFSFLPAPDRLRASASCSHWRECLFYPALWPQLRICLSVSPAE
QPRLEFLMRKCGWFVRELRVEFSAENYLSGGGPGDGGGADPGTGGEEVEALQLSTRWLEV
LRTYLELVLCVLVSIRNNRNLQKFSLFGDISVLQQQGSLSHTYLSKVDPDGKKIKQIQQL
FEEILSNSRQLKWLSCGFMLEVVTPTSLSSLSNAVANTMEHLSLLDNNIPGSSTLITAVE
LERFVNLRSLALDFCDFTAEMARILTDSNHVPLQRLSFLVHNVSVMHKSLDNMPNDEHWK
ALSRKSTGLRVYMMAFDIKSEDMLKILKPSIPLERIHFDSYITCVSGAIVDLISRQYDKF
LTHFILMNDVIDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAIARLR
GSDLKELEVTEESIDFDQGELADQDMDPVHNLIEQVSLGLGQPWHAVMDIESLSVFTEPN
RHFYREMQSFSEDI
Download sequence
Identical sequences H0WM64
ENSOGAP00000002807 ENSOGAP00000002807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]