SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002912 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002912
Domain Number 1 Region: 972-1168
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 8.12e-46
Family cAMP-binding domain 0.00017
Further Details:      
 
Domain Number 2 Region: 738-963
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.31e-25
Family Voltage-gated potassium channels 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002912   Gene: ENSOGAG00000003257   Transcript: ENSOGAT00000003264
Sequence length 1327
Comment pep:known_by_projection scaffold:OtoGar3:GL873577.1:10111149:10182417:-1 gene:ENSOGAG00000003257 transcript:ENSOGAT00000003264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGWVQRVLPQPPSSPQKTKMKEEEEAEPELEPVVEPKIEPEPQPETAPKEPEPEPGPPA
PQGPSIPPEETPKDEEVAVADPNPQETQETVPVPPSSVQAEVTVTPEVDSPRGWVMTWFR
KGMEKVVPQPVFSKEDPAQVMQGLEAGSREEGLQVLGHCGTEDEGKTKSTDVPNEDSGSG
PWLVRWLEQNLEKVLPQPPKIAEDGRDEPTDAALGPAPPESAPETKPTPQALESPSPPTP
GPQEPQEEPAPEPQSESFLLPPRDPARLVAWVLHRLEMALPQPVLHGKVGEQEPDCPETC
EVQTISILPGGQVEPDLILEEVDPDWEETHQSDNIPVETAVILVYEEENEAVEEMPRELP
RIEEEEEDVEKEEDVGEKEEEGVEKEEEVGEKEEEVGEKEEEDVEKEEEVGEKEEDDGEK
EEEVGGNKEEVGEKEEEDGEKEEEDEEKEEDDGEKEEEDEEEEEEEPKVLLDSCLVEEVC
VDQSSVEETQSLEASHQEVLEEAESKAQVESESEAASSEGKEKPQVQPASPDQGQQISFV
VPATEEHPEVQVEDTDADSCPLVVEENPPLSELQPPSPAKSDTLEVPGSASGTYRNKLPS
QDEEAEELKALAPAESPVVAWSDPTTPQDTDGQDRAVSTASHNSAIINDRLQELVKLFKE
RTEKVKEKLIDPDVTSDEESPAPTPAKKAPEPPPDTKPPEAKPAEEEHYCDMLCCKFKRR
PWKMYRFPQSIDPLTNLMYVLWLFFVVLAWNWNLWLIPVRWAFPYQTPDNIHLWLLMDYV
CDLIYFLDITLFQMRLQFVRGGDIITDKKDMRNNYLKSQRFKMDALSLLPLDFLYLKMGV
NPLLRLPRCLKYMVFFEFNNRLESVLSKAYIYRVIRTTAYLLYSLHLNSCLYYWASDYEG
IGSTHWVYDGVGNSYIRCYYWAVKTLITIGGLPDPRTLFEIIFQLLNYFTGVFAFSVMIG
QMRDVVGAATAGQTYYRSCMDSTVKYMNFYKIPKSVQNRVKTWYEYTWQSQGMLDESELM
VQLPDKMRLDLAIDVNYNIVSKVALFQQGCDRQMIFDMLKRLRSVVYLPNDYVCKKGEIG
REMYIIQAGQVQVLGGPDGKAVLVTLKAGSVFGEISLLAVGGGNRRTANVVAHGFTNLFI
LDKKDLNEILVHYPESQKLLRKKARRMLRSNNKPKEEKSVLILPPRAGTPKLFNAALAAT
GKMGGRGAKGGQLAHLRARLKELAKVLRAPATYRRLLGKAKKSQEAAGEAGGAAPDQPAP
PAAPEEPLDPPAQRSPPPASPGSPKGGTEESARPEEHSVRIHMSPGPEPDEQILSVEVPQ
EKKEEAE
Download sequence
Identical sequences H0WME9
ENSOGAP00000002912 ENSOGAP00000002912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]