SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002926 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002926
Domain Number 1 Region: 632-778
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.83e-46
Family Toll/Interleukin receptor TIR domain 0.000000132
Further Details:      
 
Domain Number 2 Region: 28-130,366-538
Classification Level Classification E-value
Superfamily L domain-like 8.5e-37
Family Leucine rich effector protein YopM 0.063
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000002926
Domain Number - Region: 230-400
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 0.0366
Family Type II DNA topoisomerase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002926   Gene: ENSOGAG00000003279   Transcript: ENSOGAT00000003281
Sequence length 782
Comment pep:known_by_projection scaffold:OtoGar3:GL873700.1:46965:49313:-1 gene:ENSOGAG00000003279 transcript:ENSOGAT00000003281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSIFCFVIPFMLILEIRIQLSDESEFLVDMSKTGLTHVPKDLSLKTTILNISHNFISEI
QTSEISSLSKLRVLIVSHNRIQHLEISVFKFNRDLEYLDFSHNKLGKISCHPTVNLKYLD
LSFNAFDALPICKEFGNMSQLKFLGLSATRLEKSRVLPIAHLNISKVLLVLGETFEEKED
LKSLQDFNTKSLHIVFPMKKEFHFILDVSFRTVINLELSNIKCLVDDSACSDFLNVLAKL
QMNPRLSNLTLNNIETTWNSFIRILQLVWHTTIEYFSMSDMKLQGKLDFRDFNYSGTSLK
ALSIHQVVSDVFNFPQSAIYKIFSDMNIQSFTVSGTRMVHILCPSQVSPFLYLDFSNNLL
TDMVFENCRNLTELKILNLQKNQLKELTKIVRMTKEMKSLQQLDISQNFLRYDEHGENCF
WTKTLLSLNMSSNILSDSIFRCLPPRLEVLDLHSNRIESIPKDVTRLESLLELNVAFNSL
TDLPGCDTFSSLSVLVIDHNSVSQPSDEFFQSCQKIRSIKAGNNPFQCTCELREFVKNTG
QVSSEVVEDWPDSYKCDYPESYKGTPLKDFHISELSCNTTLLIVTIGAIMLVVAVTVTFL
CIYLDLPWYLRMVFQWTRTRYRARNVPLEELQRALEFHAFISYSEHDAAWVKNELVPCLE
REDIRICLHERNFVPGKSIVENIINCIEKSYKSIFVLSPHFVQSEWCHYELYFAHHNVFH
KGANNLILILLEPIPQYSIPNSYHRLKTLMVRRTYLEWPKEKSKRGLFWANLRAAVNIKL
TE
Download sequence
Identical sequences H0WMG1
ENSOGAP00000002926 ENSOGAP00000002926 XP_003804000.2.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]