SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002966 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002966
Domain Number 1 Region: 26-97
Classification Level Classification E-value
Superfamily Snake toxin-like 2.08e-16
Family Extracellular domain of cell surface receptors 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002966   Gene: ENSOGAG00000003325   Transcript: ENSOGAT00000003326
Sequence length 125
Comment pep:known_by_projection scaffold:OtoGar3:GL873520.1:60612042:60624873:-1 gene:ENSOGAG00000003325 transcript:ENSOGAT00000003326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSLEKLVLLPLLFVLVILCYSGFSLKCYSCLNPVADCTSVANCTPNLDACLHTIAGPRV
YHQCWKLENCNFADISRLLGENELRYYCCSKDLCNHAENDGTTLSGKTVFALVTPFLAAA
WNFYL
Download sequence
Identical sequences H0WMJ6
ENSOGAP00000002966 ENSOGAP00000002966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]