SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003055 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003055
Domain Number 1 Region: 164-372
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.24e-43
Family DBL homology domain (DH-domain) 0.00017
Further Details:      
 
Domain Number 2 Region: 388-505
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-18
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003055   Gene: ENSOGAG00000003425   Transcript: ENSOGAT00000003428
Sequence length 600
Comment pep:known_by_projection scaffold:OtoGar3:GL873538.1:24644719:24676511:-1 gene:ENSOGAG00000003425 transcript:ENSOGAT00000003428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPELAAQKQPRLRRRSRRASRLSTESSAGPSADTPGPEPGPGPGPGPDGRYSLRRGSSF
TFLTPGPHWDFSLKRKRREKDDDVVSLSSLDLKEPSNKRVRPLARVTSLANLISPVRNGA
VRRFGQTIQSFTLRGDHRSPASAQKSFSRSTVPTPAKRRSSVLWSEMLDVNTKESLTTRE
IRRQEVRWHFPPHHSHWPILKNDAYHDPMLKLSIMSEEELAHIFGDLDSYIPLHEDLLAR
IGEATKPDGTVEQIGHILVNWLPGLHAYKGYCSNQLAAKALLDQKKQDPRVQDFLQRCLE
SPFSRKLDLWSFLDIPRSRLVKYPLLLKEILRHTPKDHPDVQLLEDAVLIIQGVLSDINL
KKGESECQYYIDKLEYLDEKQKDPRIEASRVLLCHGELRNKSGHKLYIFLFQDILVLTRP
VVRNERHAYQVYRQPIPVRDLVLEDLQDGDVRMGGSFRGAFSNSDKAKNIFRVRVQDPSP
GQCHTLQANDVFHKQQWFNCIRAAIAPFQPAASPPELRGLPELHEECEENSLSAANPPAQ
RRGSVVSSITQAEVENALECGSSVQLAEDPKSVEAPQTRPSFRRARDRAQSGGKRKETLV
Download sequence
Identical sequences H0WMR8
ENSOGAP00000003055 ENSOGAP00000003055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]