SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003065 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003065
Domain Number 1 Region: 53-177
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000698
Family Spermadhesin, CUB domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003065   Gene: ENSOGAG00000003437   Transcript: ENSOGAT00000003440
Sequence length 322
Comment pep:known_by_projection scaffold:OtoGar3:GL873536.1:11205790:11219022:1 gene:ENSOGAG00000003437 transcript:ENSOGAT00000003440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPNFKLQCHFILIFLVALRGETRYLELREAADYDPFPLFSAHLKRELAGEQPYRRALRC
LDMLSLQGQFTFTADRPQLHCAAFFIGEPEEFITIHYDLVSIDCQGGDFLKVFDGWILKG
EKFPSSQDHPLPTTERYIDFCQSGLSRRSIRASQNVAMIFFRIHEPGNGFTLTIKTDPNL
FPCNAISQTPNGRFTLVVPHQHRNCSFSIIYPAVIKISDLTLGHLNGLQLKKPSVGCGGV
GDFVELLGGAGLDPSKMMPLADLCYPFHGPAQMKIGCDNTVVRMVSSGKHINRVTFEYRQ
LEPYELESPNGNSIQEFCLSSF
Download sequence
Identical sequences H0WMS4
ENSOGAP00000003065 XP_003785976.1.62490 ENSOGAP00000003065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]