SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003076 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003076
Domain Number 1 Region: 145-478
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.87e-87
Family Protein kinases, catalytic subunit 0.0000000000137
Further Details:      
 
Domain Number 2 Region: 1-142
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.37e-38
Family Regulator of G-protein signaling, RGS 0.0000005
Further Details:      
 
Domain Number 3 Region: 512-613
Classification Level Classification E-value
Superfamily PH domain-like 4.66e-23
Family Pleckstrin-homology domain (PH domain) 0.00000649
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003076   Gene: ENSOGAG00000003448   Transcript: ENSOGAT00000003453
Sequence length 646
Comment pep:known_by_projection scaffold:OtoGar3:GL873557.1:613787:755360:1 gene:ENSOGAG00000003448 transcript:ENSOGAT00000003453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKYLEERNEITFDKIFHQKIGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKLDNEEDRL
SRSRQIYDTYIMKELLSCSHPFSKQAVEHVQSHLSKKQVTSALFQPYIEEICESLRGDIF
KKFMESDKFTRFCQWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCL
DKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYH
LSQHGVFTEKEMRFYATEIILGLEHMHSRFVVYRDLKPANILLDEHGHVRISDLGLACDF
SKKKPHASVGTHGYMAPEVLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEI
DRMTLTVNVELPDSFSPELKSLLEGLLQRDVSERLGCHGGSAQEVKEHTFFKGIDWQHVY
LQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDCDQELYKNFPLVISERWQQEVA
ETVYEAVNADTDKIEARKRAKNKQLGHEEDYALGKDCIMHGYMLKLGNPFLTQWQRRYFY
LFPNRLEWRGEGESRQNLLTMDQILSVEETQIKDKKCILFRIKGGKQFVLQCESDPEFVQ
WKKELTDTFMEAQRLLRRAPKFLNKPRSNIVELSKPPLCHRNSNGL
Download sequence
Identical sequences H0WMT1
ENSOGAP00000003076 ENSOGAP00000003076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]