SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003152 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003152
Domain Number 1 Region: 190-526
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-80
Family Protein kinases, catalytic subunit 0.00000163
Further Details:      
 
Domain Number 2 Region: 38-185
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.8e-35
Family Regulator of G-protein signaling, RGS 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003152   Gene: ENSOGAG00000003539   Transcript: ENSOGAT00000003540
Sequence length 563
Comment pep:known_by_projection scaffold:OtoGar3:GL873680.1:381891:398487:-1 gene:ENSOGAG00000003539 transcript:ENSOGAT00000003540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFGSLETVVANSAFIAARGSFDGSSTPSSRDKKYLAKLKLPPLSKCESLRDSLGLEFES
VCVEQPIGKRLFQQFLQTDERHVPALELWRDIEDYDTADDDLRPQKAQAILADYLDPKAK
LFCGFLDEGTVAKVKEGPVVSQDGLFQPLLQATLAHLSQEPFQEFLGSLHFLRFLQWKWL
EAQPMGEDWFLDFRVLGKGGFGEVSACQMKATGKMYACKKLNKKRLKKRKGYQGAMVEKK
ILAKVHSRFIVSLAYAFETKTDLCLVMTIMNGGDIRYHIYNVDEENPGFLEPRAVFYTAQ
IICGLEHLHQKRIVYRDLKPENVLLDNDGNVRISDLGLAVELMDGQTKTKGYAGTPGFMA
PELLRGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENKELKQRILSEAVKYPEKFS
QPSKDFCEALLVKDPEKRLGFRNQTCDALRVQPLFKDLNWRQLEAGMLIPPFIPDSRTVY
AKNIQDVGAFSTVKGVVFDKADTEFFQEFATGNCPIPWQEEMIETGIFGELNVWREDGQM
PDDMKGISAVETSSSKSGMCLIS
Download sequence
Identical sequences H0WMZ2
ENSOGAP00000003152 XP_003800026.1.62490 ENSOGAP00000003152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]