SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003182 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003182
Domain Number 1 Region: 279-514
Classification Level Classification E-value
Superfamily PRTase-like 5.51e-62
Family Phosphoribosyltransferases (PRTases) 0.00000671
Further Details:      
 
Domain Number 2 Region: 12-286
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.74e-59
Family Class II glutamine amidotransferases 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003182   Gene: ENSOGAG00000003571   Transcript: ENSOGAT00000003575
Sequence length 517
Comment pep:known_by_projection scaffold:OtoGar3:GL873660.1:132699:166570:1 gene:ENSOGAG00000003571 transcript:ENSOGAT00000003575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELEESGIREECGVFGCIASGEWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDGSSVPT
FKTHKGMGLVNHVFTGDNLKKLYISNLGIGHTRYATTGKCELENCQPFVVETLHGKIAVA
HNGELVNAARLRKKLLRHGVGLSTSSDSEMITQLLAYTPPQERDDTPDWVARIKNLMKEA
PTAYSLLIMHRDVIYAVRDPYGNRPLCIGRLIPVSDIKHKEKKTSETEGWVVSSESCSFL
SIGARYYREVLPGEIVEISRHNVRTLDIVSRSEGNPVAFCIFEYVYFARPDSIFEDQMVY
TVRYRCGQQLAIEAPVDADLVSTVPESATPAALGFAGKCGLPYVEVLCKNRYVGRTFIQP
NMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASP
PIRYPCFMGINIPTKEELIANKPEFDHLAEYLGANSVVYLSVEGLVSSVQEGIKFTKQKV
EKQDTVIQENGNGVECFEKNGHCTACLTGKYPVELEW
Download sequence
Identical sequences H0WN16
XP_003798847.1.62490 ENSOGAP00000003182 ENSOGAP00000003182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]