SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003196 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003196
Domain Number 1 Region: 552-620
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000707
Family HLH, helix-loop-helix DNA-binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003196   Gene: ENSOGAG00000003587   Transcript: ENSOGAT00000003590
Sequence length 666
Comment pep:known_by_projection scaffold:OtoGar3:GL873548.1:14379500:14419178:-1 gene:ENSOGAG00000003587 transcript:ENSOGAT00000003590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQPQRMAPVGTDKELSDLLDFSMMFPLPVANGKGRPTSLAGTQFGSSGLEDRPSSGSWG
TSDQNSSSFDPSRTYSEGTHFSESHSSLSSSTFLGPGLGGKGNDRSTYTPFGRDPGVGSL
TQAGFLPGELSLSSPGPLSPSGLKSSSQFFSYPGNPRRRAADGGLDTQPKKVRKVPPGLP
SSVYPPSSGDDYGRDAATYPSVKTPSSAYPAPFYMADGNLHPSAELWSSMGQAGFGPMLG
GGSSPLPLPAGSSSSVGSSGSNGGTFGGLHQHERMGYQLHGAEVNGGLPAVSTFSSTSGA
TYGSVSSHTPPVSGTDSLMGTRGTIASSSGDALGKALASIYSPDHSSNNFSSSPSTPVGS
PQGLAGTSQWARAGAPGALSPSYDGGLHGLQNKMEDHLDEAIHVLRSHAVGTAGDMQGLL
PSHGALASGFSSPMPLGGRHTSMVGGSHTEDGLTGSTSLLHNHAALPSQPSALPDLSRPP
DSYSGKPSGLGHAGAAAGAGEIKREEKEDEENTSVADNSEEDKKELKAPRTRTRCQLLLA
PPDEDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTK
LLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAAHPGLSEAH
NPTGHL
Download sequence
Identical sequences H0WN29
ENSOGAP00000003196 ENSOGAP00000003196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]