SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003225 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003225
Domain Number 1 Region: 136-303
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.3e-69
Family Cyclophilin (peptidylprolyl isomerase) 0.0000000415
Further Details:      
 
Domain Number 2 Region: 4-88
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.24e-27
Family Canonical RBD 0.0000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003225   Gene: ENSOGAG00000003620   Transcript: ENSOGAT00000003625
Sequence length 304
Comment pep:novel scaffold:OtoGar3:GL873663.1:3407293:3423845:-1 gene:ENSOGAG00000003620 transcript:ENSOGAT00000003625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDA
AAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGLE
PPKTETQEGEPVAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEK
GFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSG
PNTNGSQFFLTCDKTDWLDGKHVVFGEITEGLDVLRQIEPTKAQGSKDGKPKQKVIIADC
GEYV
Download sequence
Identical sequences H0WN53
ENSOGAP00000003225 ENSOGAP00000003225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]