SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003272 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003272
Domain Number 1 Region: 198-302
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 2 Region: 766-872
Classification Level Classification E-value
Superfamily SRCR-like 5.36e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 18-123
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 4 Region: 303-408
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 5 Region: 466-572
Classification Level Classification E-value
Superfamily SRCR-like 3.66e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003272   Gene: ENSOGAG00000003685   Transcript: ENSOGAT00000003688
Sequence length 1417
Comment pep:known_by_projection scaffold:OtoGar3:GL873783.1:382585:402348:-1 gene:ENSOGAG00000003685 transcript:ENSOGAT00000003688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVLACLLAALVGIQAVERLRLADGPHGCAGRLEVWHGGRWGTVCDDGWDLRDAAVACRQ
LGCGGALAAPGGAFFGEGTGLVWLSELACRGSEGQLGFCPHRGWKAHICSHEEDAGVVCA
GQRVANSRDNPASTLDGDSWLGLSGELSLTSEEPPVTPAPHPAGSPQNSSRKKTPRPPKQ
AKSTRAPLLTSGSPRQERLRLVSGPHGCAGRLEVWHGGRWGTVCDDGWDLRDAAVACREL
GCGGALAAPGGARFGPGSGPVWMDDVGCGGGEQALRDCPRSPWGRSNCDHSEDAGLVCTG
PAPRLRLADGPHGCAGRLEVWHSGRWGSVCDDAWDLRDAAVACRELGCGRALAAPGGAFF
GEGSGPIILDDLRCRGNETALRFCPSRTWGQHDCHHREDAGAVCDGMPLGYVPPTAPAVD
SNTSTSRQAASMPLSPTVSQALGTAGISPPPASPTAPWEPGPEVGSPQLRLVAGPSRCSG
RLEVWHDGRWGTVCDDSWDMRDSAVVCWELGCGGPRQPDPAAGRFGWGAGPIWLDDVGCV
GTESSLSDCPAALWGKHNCAHNEDVGVTCTGPPGLDSVSDPFSWSWIPGLGRDQDAWLPG
EVVTKPPASLTSSVPEKTTTKVPGKMPKSTKKWVTKNTKRPTTQPPVMPTTKHAGGLGTQ
NPPALTSWTTTTLTAEFTTRLTTETPPRQISHRTAILTSQSPQERNSKTTAILTAQGPQE
MTSEATIRKIPQASLEPSAELPAEGSPESPKEPSLSPTDSTTEKSGLFRVRLADGPNRCA
GRLEVWHAGRWGTVCDDNWDLRDATVACWELGCGKVRPRVGKTHYGPGTGPIWLDDMGCK
GSETSLTNCPSRPWGKHNCDHEEDVGLTCTGYSDEDDYPPWTWDPSSGEDLAKGTTVEGV
PGHALSWGTTRRPAVSSLSTWRLPDTGDKDGYKPPWMWDKSMGRGLVKGFPTTGKPLTHA
TGTTRSQGSPLPAPRFYGDTGSRRKQWPERRLLRPTEVRTAPLTPSPAPSASMELPSPPL
TSDSQPQLIPNLVSRPEATSNPPDTSPPTPDLASWTNPDLVFTSPHLILSTPDSSVIPMP
TPELSPPLPPTLPVGLTSDSSVLSEMTPESDTTPDLDTTPYPKTVLESSSSPNLSTSPYH
TTTPHPTITLHPATTPQPPTTPYPVTTPQLITTPQPMITTEPTMTPELTTTPQPTTAPQP
TTDPHLTSAPIFTSKFLPTSLGTELSSLTSTPTSKPSLPPELSFTTPATHTSTSQMPTLE
PSSTLESNTSSFSTAQSLEPLSTEDFESSGSQSSKPPPDHLNLGLPTGQSSGPVGPCVVP
TPPVRVMACEPPALMELVAAVRDVGGQLQRLTHVLEQDRQERQALGLGLTQLVEAAQGLG
QLGEVIKRLAEVTWPPSTPVPTTTTLEEEERPLRGDV
Download sequence
Identical sequences H0WN89
ENSOGAP00000003272 ENSOGAP00000003272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]