SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003302 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003302
Domain Number 1 Region: 828-1063
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.71e-57
Family DBL homology domain (DH-domain) 0.0000335
Further Details:      
 
Domain Number 2 Region: 1060-1189
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-34
Family Pleckstrin-homology domain (PH domain) 0.0012
Further Details:      
 
Domain Number 3 Region: 644-699
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000117
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000003302
Domain Number - Region: 133-219
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000176
Family Ankyrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003302   Gene: ENSOGAG00000003713   Transcript: ENSOGAT00000003719
Sequence length 1723
Comment pep:known_by_projection scaffold:OtoGar3:GL873536.1:8120941:8310089:1 gene:ENSOGAG00000003713 transcript:ENSOGAT00000003719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QCFDSFIFQGQMTVHATFDKNVYLPEDAEFYFIYDGSHQRHVMIAERVKDNVLQSSIPGR
GLQETVTVSVCLCSEGYSPVTMGSGSVTYVDNMACRLARLLVTQADRLTACSHQTLLTPF
ALTVGALPALDEELVLALTHLELPQGWTVLGSSQLEVSLHRESLLHLAMRWGLAKLSQFL
LCLPGGVQALALPNEEGATPLDLALRGGHTKLVEDITNFQGRRSPGFSRVQLSEDASLHY
VHSSETLTLTLNHTAEHLLEADIKLFRKYFWDRAFLNKALEQEARPEEGTALPLGPAETE
EEIKDLVSGRSSPEEEDVKCVKSLVVQPNEREDQDSADFDRSFDVLKKSKHPPASLAAGR
LSDMLNGGDEVYANCMVIDQVGDLDINYINIEGFTTNTSPESMGSTLEPQSCKHILPTET
SPGVSPLSEDSERTATIDAQQSFGSPSSSCASNLNLSLGLHGFEKEQSHLKKRSSSLDAL
DADSEGEGRSEQSHTCYTPESQSSSRTGIPSGDELDSFETNMEPDFNISRAESLSLSSSL
QSKELLLSGVRSRSYSCSSPKISLGKTQLVRDLTVCNSSEEQRAYSLPEPPREKSRIQEE
EWDKYIIPAKSESEKYKVSRTFSFLMNRMTSPRNKSKTKSKEAKDKEKVTRHQFVLGTFS
GVLQCSVCDKTLLGKESFQCSNCNASAHKGCKDTAPPCTKKFQEKYNKNKPQTILGNSSL
RDIPQPGLSLHPSSSMPIGLPTGRRETAGHVHPLSRSVPGTTLESFRRSATSLESESDGN
NCRSRSHSDELLQSVGSSPSTESFIMEDVVDSSLWSDLSSDAQEFEAESWSLVVDPSFCS
KQEKDVIKRQDVIFELMQTEMHHIQTLFIMAEIFRKGMKEELQLDHSTVDKIFPCLDELL
EIHRHFFYSMKERRQESSVGNDRNFVINRIGDILVQQFSEENASKMKKIYGEFCSHHKEA
VNLFKELQQNKKFQNFIKLQNSNLLARRRGIPECILLVTQRITKYPVLVERILQYTKERT
EEHKDLCKALGLIKDMIATVDLKVNEYEKNQKWLEILNKIENKTYTKLKNGHVFRKQALL
SKERTLLYDGLVYWKTATGRFKDILALLLTDVLLFLQEKDQKYIFAAVDQKPSVISLQKL
IAREVANEERGMFLISASSAGPEMYEIHTNSKEERNNWMRRIQQAVESCPEEEGGRTSES
DEERRKAEARVAKIQQCQEILTNQDQQICTYLEEKLRIYAELGELSGFEDAHLEPHLLIK
PDPGEAPQAASLLTAALKEAESLHVAVKASQTSDVSQSSEDGCGDSVLTDTSSSHDVPGS
PTASLVPEGREGRGCWDVDPGIQGVVTDLAVSDAGEKVEYRSFAGSSQSEIIQAIQNLTR
LLYSLQAALTIQDSHIEIHKLVLRQQESLALCHPLLRGSPWQEQEKAREEPADAGQLQRQ
LQQEQRRWQRGWEQQQRAQAARERGLRERERQCRAQEERLLRGRGELEHQRQEYQHSLER
LREGQRLVERERAGVRGQQGLLGHWRHSRQRSLPTAFPLCAEEVVELNRSESLCHENSFF
INEALVQMSLNTFNKPNPSRIQQDAVSPPNVSYSDLVRTSENQVDLKTDISQPSDVNHEL
WTATGPCHQIPPLYESRKDSYENASSMRKRSCTLRSLLGLQTEAISTLKDLDTSQAASPT
PHDSYSPHPPLQTFITEAKLNLQTTTRQDGEIGDGAEENIVYL
Download sequence
Identical sequences H0WNB3
ENSOGAP00000003302 ENSOGAP00000003302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]