SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003358 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003358
Domain Number 1 Region: 203-462
Classification Level Classification E-value
Superfamily RNI-like 3.34e-46
Family Cyclin A/CDK2-associated p19, Skp2 0.062
Further Details:      
 
Domain Number 2 Region: 99-180
Classification Level Classification E-value
Superfamily F-box domain 0.00000000249
Family F-box domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003358   Gene: ENSOGAG00000003778   Transcript: ENSOGAT00000003780
Sequence length 477
Comment pep:known_by_projection scaffold:OtoGar3:GL873563.1:6882372:6885328:-1 gene:ENSOGAG00000003778 transcript:ENSOGAT00000003780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPGINGDPKPPCLPRNGLVKLPGQPNGLGAASITKGTPAAKNRPCLPPPPPSLPPPNL
ATPLARAVLSGGPPASGPASALVPGPPEERPPLATDEKILSGLFWYFSACEKCVLAQVCK
AWRRVLYQPKFWAGLTPVLHAKELYNVLPGGEKEFVNLQGFAARGFEGFCLVGVSDLDIC
EFIDNYALSKKGVKAMSLKRSTITDAGLEVMLEQMQGVVRLELSGCNDFTEAGLWSSLSA
RITSLSVSDCINVADDAIAAISQLLPNLAELSLQAYHVTDTALAYFTARQGHSTHTLRLL
SCWEITNHGVVNVVHSLPNLTSLSLSGCSKVTDDGVELVAENLRKLRSLDLSWCPRITDM
ALEYVACDLHRLEELVLDRCVRITDTGLSYLSTMSSLRSLYLRWCCQVQDFGLKHLLAMR
SLRLLSLAGCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE
Download sequence
Identical sequences H0WNF8
XP_012661216.1.62490 ENSOGAP00000003358 ENSOGAP00000003358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]