SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003502 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003502
Domain Number 1 Region: 98-243
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 5.36e-32
Family AlaX-like 0.023
Further Details:      
 
Domain Number 2 Region: 3-96
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000000141
Family AlaX-M N-terminal domain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003502   Gene: ENSOGAG00000003934   Transcript: ENSOGAT00000003938
Sequence length 412
Comment pep:known_by_projection scaffold:OtoGar3:GL873537.1:21307018:21318094:1 gene:ENSOGAG00000003934 transcript:ENSOGAT00000003938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFRCQRDSYAREFTTTVVSCSPAELQTEGSNGKKEVLSGFQVVLEDTLLFPEGGGQPDD
RGTINDISVLRVTRRGAQADHFTQTPLAPGSQVLVQVDWERRFDHMQQHSGQHLITAVAD
HLFGLKTTSWELGRLRSVIELDSPSVTTEQVAAIEQSVNEKIRDRLPVNVRELSLDDPEV
EQVRGRGLPDDHAGPIRVVTIKGVDSNMCCGTHVSNLSDLQVIKILGTEKGKKNKTNLIF
LAGNRVLKWMERSHGTEKALTALLKCGAEDHVEAVKKLQNSTKLLQKNNLNLLRDLAVHI
AHSLRNSSDWGGVVTLHRKEGDSEFMNIIANEIGSEETLLFLTVGDEKGAGLFLLTGPAE
AVETLGPRVAEVLEGKGAGKKGRFQGKATKMSRRAEAQALLQDYISTQSAEE
Download sequence
Identical sequences H0WNT0
ENSOGAP00000003502 ENSOGAP00000003502 XP_012658502.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]