SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003515 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003515
Domain Number 1 Region: 20-181
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.39e-49
Family G proteins 0.000000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003515   Gene: ENSOGAG00000003948   Transcript: ENSOGAT00000003952
Sequence length 208
Comment pep:known_by_projection scaffold:OtoGar3:GL873521.1:37075321:37108293:1 gene:ENSOGAG00000003948 transcript:ENSOGAT00000003952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ
TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVESFARAKNWVKELQRQASPNIV
IALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQ
NPGANSARGRGVDLTEPTQPTRSQCCSN
Download sequence
Identical sequences H0WNU1
ENSOGAP00000003515 ENSOGAP00000003515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]