SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003655 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003655
Domain Number 1 Region: 11-235
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.33e-59
Family DBL homology domain (DH-domain) 0.0000172
Further Details:      
 
Domain Number 2 Region: 221-362
Classification Level Classification E-value
Superfamily PH domain-like 6.97e-34
Family Pleckstrin-homology domain (PH domain) 0.00069
Further Details:      
 
Domain Number 3 Region: 382-492
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.41e-28
Family DEP domain 0.003
Further Details:      
 
Domain Number 4 Region: 477-606
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.73e-28
Family DEP domain 0.0011
Further Details:      
 
Domain Number 5 Region: 677-743
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000434
Family PDZ domain 0.017
Further Details:      
 
Domain Number 6 Region: 580-672
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000434
Family PDZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003655   Gene: ENSOGAG00000004092   Transcript: ENSOGAT00000004102
Sequence length 1605
Comment pep:known_by_projection scaffold:OtoGar3:GL873632.1:4011866:4299403:1 gene:ENSOGAG00000004092 transcript:ENSOGAT00000004102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDESRGDGRAESAKDLEKQLRLRVCVLSELQKTERDYVGTLEFLVSAFLHRMNQCAASK
VDKNVTEETVKMLFSNIEDILVVHQEFLKVVEECLHPEPSAQHDVGTCFLHFKDKFRIYD
EYCSNHEKAQKLLLELNKIRTVRTFLLNCMLLGGRKNTDVPLEGYLVTPIQRICKYPLIL
KELLKRTPRKHSDYAAVMEALQAMKAVCSNINEAKRQMEKLEVLEEWQSHIEGWEGSNVT
DTCTEMLMCGVLLKISSGNIQERVFFLFDNLLVYCKRKHRRLKNSKASTDGHRYLFRGRI
NTEVMEVENVDDGTADFHSSGHIVVNGWKIHNTAKNKWFVCMAKTPEEKHEWFEAILKER
ERRKGLKLGMEQDTWVMISEQGEKLYKMMCKQGNLIKDRKRKLTTFPKCFLGSEFVSWLL
EIGEIHRPEEGVHLGQALLENGIIHHVTDKHQFKPEQMLYRFRYDDGTFYPRNEMQDVIS
KGVRLYCRLHSLFTPVIRDKDYHLRTYKSVVMANKLIDWLIAQGDCRTREEAMIFGVGLC
DNGFMHHVLEKSEFKDEPLLFRFFSDEEMEGSNMKHRLMKHDLKVVENLIAKSLLIKSNE
GSYGFGLEDRNKVPIIKLVEKGSNAEMAGMEVGKKIFAINGDLVFMRPFNEVDCFLKSCL
NSRKPLRVLVSTKPRETVKIPDSADGLGFQIRGFGPSVVHAVGRGTVAAAAGLHPGQCII
KVNGINVSKETHASVIAHVTACRKYRRPMKQDSIQWVYNSIESAQEDLQKSNSKPSGDEA
GDAFDCKVEEVIDKFNTMAIIDGRKEHVSLTVDNVHLEYGVVYEYDSTAGIKCNVVEKMI
EPKGFFSLTAKILEALAKSDDHFVQNCTSLNSLNDVIPADLQSKFSAMCSERIDHIRQRI
SSYKKFSRVLKNRAWPTFKQAKSKISPLHSSDFCPTNCHVNVMEVSYPKTSTSLGSAFGV
QLDSRKHNSHDKENKSSEQGKLSPMVYVQHTITTMAAPSGLSLGQQDGHGLRYLLKEEDL
ETQDIYQKLLGKLQTAMKEVEMCVCQIDDLLSSITYSPKLERKTSECIIPTDSDNERGER
NSKRVCFNVTGDEQEDSGHDTISNRDSYSDCNSNRNSIASFTSICSSQCSSYFHSDEMDS
GDELPLSVRISHDKQDKIHSCLEHLFSQVDSITNLLKGQAVVRAFDQTKYLTPGRGLQEF
QQEMEPKLSCPKRLRLHIKQDPWNLPSSVRTLAQNIRKFVEEVKCRILLALLEYSDSETQ
LRRDMVFCQSLVASVCAFSEQLMAALNQMFDNSKENEMETSEASRRWLEQITNAGVLFHF
QSLLSPNLTDEQAMLEDTLVALFDLEKVSFYFKPSQEEPLVANVPLTYQAEGSRQALKVY
FYIDSYHFEQLPQRLKELQGWKIHLLVYTALESMEGYYYRDNVSVEEFQAQINAASLEKV
KQYNQKLRAFYLDKSNSPPNSTSKAAYIDKLMRPLNALDELYRLVSSFIRSKRTAACANT
ACSASGVGLLSVSSELCSRLGGCHIIMCSSGVHRCTLSVTLEQAIILARSHGLPPRYIMQ
ATDVMRKQGARVQNTAKNLGVRDRTPQSAPRLYKLCEPPPPAGEE
Download sequence
Identical sequences H0WP62
ENSOGAP00000003655 ENSOGAP00000003655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]