SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004172 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004172
Domain Number 1 Region: 4-74
Classification Level Classification E-value
Superfamily F-box domain 3.01e-20
Family F-box domain 0.0017
Further Details:      
 
Domain Number 2 Region: 119-295,354-409
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000000696
Family WD40-repeat 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004172   Gene: ENSOGAG00000004670   Transcript: ENSOGAT00000004673
Sequence length 454
Comment pep:known_by_projection scaffold:OtoGar3:GL873698.1:570713:577890:1 gene:ENSOGAG00000004670 transcript:ENSOGAT00000004673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIHLPEEVVRYIFSFLEASSLLQVSQVNKFWNSVADSEHLWRKLCLKRWGFWDFTCKCL
GTQTWKQSFLHRIKKERRMALAQPDDFIYKETSGDFGVFEELAYLSGKNLRIDEKEKSII
CITTSKHVLYAWDVQEGIMIWSSPVQPFKMNKLTTIPQMHLAITSDFGGTIKVWNCQDRD
ALADITVPSVCISLEACFSKDTPFIMVGISAGDIYTFTVPDLTTVSHINAFEYSMNLLYC
SPDKNWVFACRTHQHVLPKVFFTESLLRPSEGSTPLSCSLSFSSCCGACWTPRKESTITL
MFRKSTTRRMGFATFDITMKKTGDKTEIQAHLIGSFLLPVDMSLSLWMGISPENLIVCES
GPCLFLFTISGLLLQQFENYQTNISLWADSLHVVTVSVDNSLHMYMWEEEGRYPYLKSCC
HLAHKQHRELQLGTCSSVVRVPATYTGAGKFESS
Download sequence
Identical sequences H0WQE8
ENSOGAP00000004172 ENSOGAP00000004172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]