SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004192 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004192
Domain Number 1 Region: 394-581
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.56e-47
Family Eukaryotic proteases 0.0011
Further Details:      
 
Domain Number 2 Region: 110-217
Classification Level Classification E-value
Superfamily SRCR-like 1.09e-16
Family Scavenger receptor cysteine-rich (SRCR) domain 0.01
Further Details:      
 
Domain Number 3 Region: 258-295
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 44-104
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000972
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Domain Number 5 Region: 223-255
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000111
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004192   Gene: ENSOGAG00000004690   Transcript: ENSOGAT00000004693
Sequence length 590
Comment pep:known_by_projection scaffold:OtoGar3:GL873648.1:455910:488597:-1 gene:ENSOGAG00000004690 transcript:ENSOGAT00000004693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSLLLSYCLFCIVQLTLTSDTPQEDLVEKTCLAKKYTHLSCSKVFCHPWQKCIEGTCVCK
LPYQCPKNGSVVCATNGRSYPTYCHLKSVECIYPGTKFLNNGTCPAEGKFSVSLHGNKNS
EGVVEVKLVDQDTKMFICHSSWSMTEANVACLDLGFQQGALNTQRRFGISEEPYINSTEC
LHVHCWGFETSLAECTFTKRRTKESQDLAGVVCYTQDADLPTDKSFRCVNGKYIAQRKAC
DGVNDCGDQSDELCCKGCRGDSFFCKSGVCIPSQFKCDGEVDCLSGEDEVGCEGARHPAT
QGFVLVAQEETEILTDDMNEERKRIKSSFPKLSCGVKNSLHTKLLSPLQGQTKTIGDKIP
GTVYIKLAGSKACEGIINTSTWSNSLVPHYRVTRSHRYQIWTSLIDWIKPNAETKVERVN
RIIIHEKYNGSTYQNDIALIEMKGYPKPGICKLPKSVPACVPWSPYLFQPNSRCIISGWG
REKDDQKVFALQWGEVYLIGNCSKFYQNRFYEKEMECAGTVDGSIDACKGDSGGPLTCTD
ANNVTYVWGVVSWGENCGQPEFPGVYTKVANYFDWISYHVGRPLISQHNM
Download sequence
Identical sequences H0WQG5
ENSOGAP00000004192 ENSOGAP00000004192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]