SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004220 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004220
Domain Number 1 Region: 43-158
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-33
Family Spermadhesin, CUB domain 0.0002
Further Details:      
 
Domain Number 2 Region: 175-298
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.94e-19
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 296-332
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000301
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004220   Gene: ENSOGAG00000004721   Transcript: ENSOGAT00000004722
Sequence length 498
Comment pep:known_by_projection scaffold:OtoGar3:GL873577.1:453162:499181:-1 gene:ENSOGAG00000004721 transcript:ENSOGAT00000004722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASYDACKLLRLLLITILVVEGIAVAQKTQDGQNIGIKHVPATQCGIWVRTSNGGQFASPN
YPDSYPPNKECIYILEAAPRQRIELAFDERYYIEPSFECRFDHLEVRDGPFGFSPLIDRY
CGMKSPPLIRSTGRFMWIKFSSDEELEGLGFRAKYSFIPVTDPDFTYLGGILNPIPDCQF
ELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIRATPRAKIYLRFLDYQMEHSNECKRNFV
AVYDGSSSIENLKAKFCSTVANDVMLKTGIGVIRMWADEGSRLSRFRMLFTSFVEPPCTG
STFFCHSNMCINDSLVCNGVQNCAYPWDENHCKEKKKSGLFEQITKTHGTIIGITSGIVL
VLLIISILVQVKQPRKKVMACKTAFSKTGFQEVFDPPHYELFSLRDKEMSADLADLAEEL
DGYQKVRRPSSASRCVHDHHCGSQAPSVRQSRTNLSAMELPFRNDFAQPQPMDNISSEFK
KLSDAAEKGHNGPSELSE
Download sequence
Identical sequences H0WQI9
ENSOGAP00000004220 ENSOGAP00000004220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]