SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004234 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004234
Domain Number 1 Region: 57-371
Classification Level Classification E-value
Superfamily RNI-like 2.13e-63
Family 28-residue LRR 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004234   Gene: ENSOGAG00000004735   Transcript: ENSOGAT00000004738
Sequence length 415
Comment pep:known_by_projection scaffold:OtoGar3:GL873603.1:7365249:7396004:-1 gene:ENSOGAG00000004735 transcript:ENSOGAT00000004738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VARLQRDYHNLCLDKSQRVNPFISRRLQELYEEVTKGGEEGITLNITGNSRLAPVERVTG
EDFWILSRVLKNCLYINGLDVRYNLLGDVGAYYSSKLIQKQLNLVYLNLMFNDIGPEGGE
MIAKALHKNKTLKYLRMTGNKIENKGGMCFATMLQINSSLQKLDLGDCDLGMQSVIAFAT
VLTQNQAIKGINLNRPILYGEQEESTVHLGHMLKENHVLVELHLCKHGIKSFGMQQLCEA
LRLNSALRYLDVSCNQITRDGMMYLANVLKSNTTLEVIDLSFNRIENVGADYLSKTLTSH
NRSLKALSVVSNNIEGEGLVALSAAVRTNPVFSNIYIWGNKFDEATCVAYSELIQMGHLK
PEDTDVEPFTVDGHVHLAEVSHGLKKHYYWTPSIGEAHGHSANAGFALIPVGQHI
Download sequence
Identical sequences H0WQK2
ENSOGAP00000004234 ENSOGAP00000004234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]