SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004272 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004272
Domain Number 1 Region: 35-318,413-463
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.89e-16
Family FAD-linked reductases, N-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004272   Gene: ENSOGAG00000004776   Transcript: ENSOGAT00000004780
Sequence length 490
Comment pep:known_by_projection scaffold:OtoGar3:GL873587.1:5515592:5533571:-1 gene:ENSOGAG00000004776 transcript:ENSOGAT00000004780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRHSVAKLVSSLLGLWLLLCSWGRLGSADLRAPPNKIAIIGAGIGGTSAAYILRQKFGKD
VKIDIFEREEVGGRLATMMVQGQEYEAGGLSALQFSGGLVGVYDGETLVFEESNWFIINM
IKLIWRYGFQPLRMHMWVEDLLGKFMRYIYQYITFSIFFKSSVFPPLYTTLADSSFMGLL
EMMISLWTEKLGKTFQRRNYFLQSLLFIYFLQTLLVSLLTGAVSLSASDSGLWAVEGGNK
LVCSGLLQASKSNLISGSVMYIEEKTRTKQKGNPTKMYEVVYQTRSETHSDFYDIVLVAT
PLNRKMSNITFLNFDPPIQEFHQYYEHIVATLVKGELNSSLFSSRALDNFGLSTILTTDN
SDLFINSLGIMSSIRQTESPQPSTDGTYVWKMFSPETLTKAQILKLFLSYDYAVKKPWLA
YPHYEPPQKCPSIILHDRLYYTSGIECAASAMEMSAIAGYNAALLAYHRWNENTDMIDQD
GLYEKLKTEL
Download sequence
Identical sequences H0WQN5
ENSOGAP00000004272 ENSOGAP00000004272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]