SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004356 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004356
Domain Number 1 Region: 110-436
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.45e-39
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000627
Further Details:      
 
Domain Number 2 Region: 465-593
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.75e-33
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000791
Further Details:      
 
Domain Number 3 Region: 12-105
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.04e-25
Family Thioltransferase 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004356   Gene: ENSOGAG00000004878   Transcript: ENSOGAT00000004881
Sequence length 595
Comment pep:novel scaffold:OtoGar3:GL873620.1:604002:654294:-1 gene:ENSOGAG00000004878 transcript:ENSOGAT00000004881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPPEDREEVRRRLMGLIEGNRVMIFSKSYCPYSTRVKELFSSLGIGCNILELDQIDDGAN
VQEVLSEISNQKTVPNIFVNKVHVGGCDRTFQAHQNGLLQKLLQEDSAYDYDLIVIGGGS
GGLACAKEAAILGKKVMVLDFVVPSPQGTSWGLGGTCVNVGCIPKKLMHQAALLGQALHD
SRKFGWEYNQHVRHSWETMIEAVQNHIGSLNWGYRLSLREKSVAYVNSYGEFVEHHKIKA
TNRKGQETCYTAAKFVIATGERPRYLGIQGDKEYCITSDDLFSLPHCPGKTLVVGASYVA
LECAGFLAGLGLEVTVMVRSVLLRGFDQEMAEKVGSYMEQHGVKFLRKFVPVMVQQLEKG
SPGKLKVSAKSTEGPETIEGIYNTLLIFVISDPCTRKIGLEKIGVKINEKNGKIPVNDVE
QTNVPYVFAIGDVLEGKPELTPVAIQAGKLLARRLFGAASEKCDYVNIPTAVFTPLEYGC
CGLSEEKAVEAYKKENLEVFHSFFWPLEWTLAGRDNNTCYAKIICNKLDHDRIIGLHILG
PNAGEVTQGFAAAMKCGLTKQQLDDTIGIHPTCGEVFTALEITKSSGLDITQKGC
Download sequence
Identical sequences H0WQU5
ENSOGAP00000004356 ENSOGAP00000004356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]