SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004381 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004381
Domain Number 1 Region: 127-321
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.49e-59
Family Astacin 0.0000938
Further Details:      
 
Domain Number 2 Region: 748-859
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-38
Family Spermadhesin, CUB domain 0.00015
Further Details:      
 
Domain Number 3 Region: 444-546
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.28e-36
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 4 Region: 593-703
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-36
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 5 Region: 328-437
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.07e-35
Family Spermadhesin, CUB domain 0.00084
Further Details:      
 
Domain Number 6 Region: 884-977
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.23e-30
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 7 Region: 551-589,704-750
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000361
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004381   Gene: ENSOGAG00000004905   Transcript: ENSOGAT00000004911
Sequence length 988
Comment pep:known_by_projection scaffold:OtoGar3:GL873593.1:6877041:6918095:-1 gene:ENSOGAG00000004905 transcript:ENSOGAT00000004911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGVARLPLPLLLWLLLLPRPGRPLDLADYTYDLGEEDDPEPLNYKDPCKAAAFLGDIAL
DEEDLRAFQVQQAADLRQRSLRRSSVKATVLGNSSSPSCQHASGQPPQETCGRWKGRSRS
RRAATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVF
TFRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDRHVSIVR
ENIQPGQEYNFLKMEVQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPP
IGQRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCIWRISVTPGE
KIILNFTSMDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGGKLPEPIVSTDSRLWVEFRS
SSNWVGKGFFAVYEAICGGDVKKDNGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQ
SFEIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKA
GFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKL
NGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTAD
SKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDC
VNTFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPDKYPSKKECTWAIS
STPGHRVKLTFVEMDIESQPECAYDHLEVFDGRDTKAPVLGRYCGSKKPEPVLATGNRMF
LRFYSDNSVQRKGFQASHSTECGGQVRADVKTKDLYSHAQFGDNNYPGGLDCEWVIMAEE
GYGVELVFQTFEVEEETDCGYDYMELFDGYDSTAPRLGRYCGSGPPEEVYSAGDSVLVKF
HSDDTITKKGFHLRYTSTKFQDTLHSRK
Download sequence
Identical sequences H0WQW7
ENSOGAP00000004381 ENSOGAP00000004381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]