SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004466 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004466
Domain Number 1 Region: 390-756
Classification Level Classification E-value
Superfamily ARM repeat 2.59e-38
Family Plakophilin 1 helical region 0.016
Further Details:      
 
Domain Number 2 Region: 78-298
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000000288
Family Cyclin A/CDK2-associated p19, Skp2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004466   Gene: ENSOGAG00000004996   Transcript: ENSOGAT00000005002
Sequence length 766
Comment pep:known_by_projection scaffold:OtoGar3:GL873606.1:8495468:8516105:1 gene:ENSOGAG00000004996 transcript:ENSOGAT00000005002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDTPESLMALCTDFCLRNLDGTLGYLLDKETLRLHPDIFLPSEICDQLVNEYVELVNA
ACNFEPHESFFSLFSDPRSTRLTRIHLREDLVQDQDLEAIRKQDLVELYLTNCEKLSAKS
LQTLRSFSHTLVSLSLFGCANIFYEEENPGGCEDECLVNPTCQVLVKDFTFEGFSRLRFL
NLGRMIDGIPVESLLRPLNSLAALDLSGIQTSDAAFLTQWKDSLVSLVLYNMDLSDDHIR
VIVQLHKLRHLDISRDRLSSYYKFKLTRKVLSLFVQKLGNLMSLDISGHMILENCSISKM
EEEAGQTSIEPSKSSIMPFRALKRPLQFLGLFETSLCRLTHIPAYKVSGDKNEEQVLNAI
EAYTEHRPEITSRAINLLFDIARIERCNQLLRALKLVITALKCHKYDKNIQVTGSAALFY
LTNSEYRSEQSVKLRRQVIQVVLNGMESYQEVTVQRNCCLTLCNFSIPEELEFQYRRVNE
LLLSILNPTRQDESIQRIAVHLCNALVCQVDNDHKEAVGKMGFVVTMLKLIQKKLLDKIC
DQVMEFSWSALWNITDETPDNCEMFLNFNGMKLFLDCLKEFPEKQELHRNMLGLLGNVAE
VKELRPQLMTSQFISVFSNLLESKADGIEVSYNACGVLSHIMFDGPEAWGVCEPQREEVE
ERMWAAIQSWDINSRRNINYRSFEPILRLLPQGISPVSQHWATWALYNLVSVYPDKYCPL
LIKEGGMPLLRDMIKMSTARQETKEMARKVIEHCSNFKEENMDTSR
Download sequence
Identical sequences H0WR37
ENSOGAP00000004466 XP_012663752.1.62490 ENSOGAP00000004466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]