SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004513 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004513
Domain Number 1 Region: 1451-1622
Classification Level Classification E-value
Superfamily Fibronectin type III 1.97e-28
Family Fibronectin type III 0.00000909
Further Details:      
 
Domain Number 2 Region: 908-1076
Classification Level Classification E-value
Superfamily Fibronectin type III 8.55e-26
Family Fibronectin type III 0.00053
Further Details:      
 
Domain Number 3 Region: 1634-1797
Classification Level Classification E-value
Superfamily Fibronectin type III 3.54e-24
Family Fibronectin type III 0.0000137
Further Details:      
 
Domain Number 4 Region: 1265-1439
Classification Level Classification E-value
Superfamily Fibronectin type III 2.71e-23
Family Fibronectin type III 0.00000983
Further Details:      
 
Domain Number 5 Region: 726-891
Classification Level Classification E-value
Superfamily Fibronectin type III 1.45e-22
Family Fibronectin type III 0.00067
Further Details:      
 
Domain Number 6 Region: 1815-1983
Classification Level Classification E-value
Superfamily Fibronectin type III 3.69e-22
Family Fibronectin type III 0.0000175
Further Details:      
 
Domain Number 7 Region: 408-463
Classification Level Classification E-value
Superfamily Kringle-like 7.42e-21
Family Fibronectin type II module 0.0000458
Further Details:      
 
Domain Number 8 Region: 348-403
Classification Level Classification E-value
Superfamily Kringle-like 1.14e-20
Family Fibronectin type II module 0.0000586
Further Details:      
 
Domain Number 9 Region: 1173-1261
Classification Level Classification E-value
Superfamily Fibronectin type III 9.84e-17
Family Fibronectin type III 0.00000329
Further Details:      
 
Domain Number 10 Region: 557-603
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000837
Family Fibronectin type I module 0.0017
Further Details:      
 
Domain Number 11 Region: 515-559
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000249
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 12 Region: 230-273
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000916
Family Fibronectin type I module 0.00013
Further Details:      
 
Domain Number 13 Region: 467-508
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000128
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 14 Region: 618-696
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000018
Family Fibronectin type III 0.00000603
Further Details:      
 
Domain Number 15 Region: 93-138
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000222
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 16 Region: 184-227
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000497
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 17 Region: 141-181
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000275
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 18 Region: 51-90
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000824
Family Fibronectin type I module 0.00031
Further Details:      
 
Domain Number 19 Region: 306-344
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000903
Family Fibronectin type I module 0.00036
Further Details:      
 
Domain Number 20 Region: 1093-1180
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000268
Family Fibronectin type III 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004513   Gene: ENSOGAG00000005042   Transcript: ENSOGAT00000005051
Sequence length 1987
Comment pep:known_by_projection scaffold:OtoGar3:GL873532.1:16754085:16808395:1 gene:ENSOGAG00000005042 transcript:ENSOGAT00000005051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRDPGPGLRLLAVLCLGTAVLSTGASKSKRQAQQIVQPQVPVPVSQNKLGCYDNGQHYH
INQQWERTYLGNALICTCYGGSRGFNCESKPEPEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDSRGNLLQCLCTGNGRGEWKCERHASLQTTATGPGSFADVRTAIYQPQPHP
QPAPYGHCVTDSGVVYSVGMQWLKTQGNQQMVCTCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCVAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETRTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPGTTGPVQVIITETPSQPNSHPIQWNAPEPSHISKYILRWRPKNSVGNWKEATIP
GHLNSYTIKGLRPGVIYEGQLISIQHYGQREVTRFDFTTPSANAPVTSNTVTGETTPFSP
VVATSESVTEITSSSFVVSWVSASHTVSGFRVEYELSEEGDEPQYLDLPNTATSVNIPDL
LPGRKYIVNVYQISEEGEQSLILSTSQTTAPDAPPDPSVEQVDDTSIVVRWSKPQAPITG
YRIVYSPSVEGSSTELTLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVFIQQETTG
VPRADKVPPPRDLQFVEVTDVKVTIMWTPPQSAVTGYRVEVIPVNLPGEHGQRLPPSRNT
FAEISGLSPGVTYYFKVFAVNHGRESKPLTAQQTTKLDAPTNLQFINETDTSVLVIWTPP
RARIAGYRLTVGPTRGGQPKQYNVGPSASKYPVRNLQPATEYTVSLTAVKGNQQSPKVTG
VFTTLQPQSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVV
SGLTPGVEYVYTIQVLRDGQERDPPIVNTVVTPLSPPTNLHLETNPDTGVLTVSWERSTT
PDISGYRITTTPTNGQQGYSLEEVVHADQNSCTFENLSPGLEYNVSVYTVKDDKESVPIS
DTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSV
GYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAP
PASIDLTNFVVRYSPVKNEDDVAELSISPSDNVVVLTNLLPGTEYLISVSSVYEQHESTP
LKGRQKTGLDSPTGIDFSDITPNSFTVHWMAPRAPISGYEIRHHPEHQSGRPRKDRVPPS
RNSITLTNLNPGTEYVVSIIAVNGKEESPALVGQQSTVSDVPRDLEVVAATPTSLLISWD
APAVTVRYYRITYGETGGNSPVQEITVPGSKSTATITGLKPGVDYTITVYAVTGRGDSPA
SSKPISINYRTEIDKPSQMQVTDVQDNSISVRWLPSSSPVTGYRVTTTPKNGPGPSKTKM
ASPDQTEMTIEGLQPTVEYVVSVYAQNRNGESQPLVQTAVTNIDRPKGLAFTDVDVDSIK
IAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHGDM
ESQPLIGTQSTAIPAPTNLKFTQVTPTSLSAEWTAPDVQLTGYRVRVTPKEKTGPMKEIN
LSPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETT
ITISWRTKTETITGFQVDAIPANGQTPIQRIIRPEIRSYTITGLEPGTEYTIYVIALKNN
QKSEPLI
Download sequence
Identical sequences H0WR76
ENSOGAP00000004513 ENSOGAP00000004513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]