SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004515 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004515
Domain Number 1 Region: 1-356
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.52e-48
Family GDI-like N domain 0.0000000013
Further Details:      
 
Domain Number 2 Region: 391-436
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.44e-16
Family GDI-like N domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004515   Gene: ENSOGAG00000005051   Transcript: ENSOGAT00000005053
Sequence length 447
Comment pep:known_by_projection scaffold:OtoGar3:GL873538.1:24406550:24427736:1 gene:ENSOGAG00000005051 transcript:ENSOGAT00000005053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDQNPYYGGESASITPLEDLYKRFQIPG
SPPASMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVP
STEAEALASSLMGLFEKRRFRKFLVYVANFDEKDTRTFEGVDPNKTTMRDVYKKFDLGQD
VVDFTGHALALYRTDDYLDQPCCETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFAR
NRAPAPYAGGGRFKPSPGQKLPKKKKIVAFKSEFHIARCKQLICDPSYVKDRVEKVGQVI
RVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISSAHNVAAQGKYIAIVSTTVE
TKEPEKEIKPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIK
DIYKRMTGSEFDFEEMKRKKNDIYGED
Download sequence
Identical sequences H0WR78
ENSOGAP00000004515 ENSOGAP00000004515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]