SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004520 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004520
Domain Number 1 Region: 262-482
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.42e-54
Family DBL homology domain (DH-domain) 0.0000839
Further Details:      
 
Domain Number 2 Region: 472-611
Classification Level Classification E-value
Superfamily PH domain-like 2.07e-17
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 
Domain Number 3 Region: 624-685
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000134
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004520   Gene: ENSOGAG00000005057   Transcript: ENSOGAT00000005059
Sequence length 705
Comment pep:known_by_projection scaffold:OtoGar3:GL873586.1:1890878:1904642:1 gene:ENSOGAG00000005057 transcript:ENSOGAT00000005059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSERYSDSSLEDKLLEHRFHSELRLDANGNPAPGLPMVRGSLQVRANAAFQSEAPAPPGD
EESRPVVLSTQSPVALKMGTQQLIPKSLAVASKAKTPARHQSFGAAVLSREAARRGPPLL
AVPSFSLDDMDMDMDSGPGGMLRRNLRNQSYRAAMKGPGQPSSQGESVQLSPKLQALAEE
PSRPARCPVKNKRTLGRKRAHKGSFKDDPQFYQEIQERGLNTSPESDDDVLDDPTSPEGT
RKVDSTIVVKSYRPAQVTWSQLPEVVESGVLDTLPAEERKRQEAIFEILTSEFSYQHSLS
VLVAEFLQSRELRASMTQTEHHHLFSNILDVLGASQKFFEDLEQRHKAQVLVEDISDILE
VHAEQHFHPYVAYCSNEVYQQRTLQRLTSSSATFREVLREIERRPACGGLPMISFLILPM
QRVTRLPLLTDTLCLKSQGHPERYQAANRALKAISKLVRRCNQGAHQMERTEQMYTLHTQ
LDFGKVKSLPLISASRWLLKRGEVFLVEETGLFRKLASRPTYYLFLFNDVLVVTKKKSED
SYVVQDYAQMEHLRVQKMEPSELPLLGGGNRSSSVPHPFQVTLLHNSEGRQEQFLLYSDS
ASDRARWIMALTYGERQGQGPTNKGDLPQVEVTKAFFAKQADELTLQQADVVLVLHQEDG
WLYGERLRDGETGWFPEDFARFITSRMAVEGNVRRMERLRVETDV
Download sequence
Identical sequences H0WR83
ENSOGAP00000004520 ENSOGAP00000004520 XP_003793261.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]