SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004548 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004548
Domain Number 1 Region: 361-581
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-53
Family DBL homology domain (DH-domain) 0.00034
Further Details:      
 
Domain Number 2 Region: 722-783
Classification Level Classification E-value
Superfamily SH3-domain 7.09e-16
Family SH3-domain 0.0017
Further Details:      
 
Domain Number 3 Region: 581-704
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000063
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004548   Gene: ENSOGAG00000005086   Transcript: ENSOGAT00000005090
Sequence length 806
Comment pep:known_by_projection scaffold:OtoGar3:GL873528.1:7854368:7864860:1 gene:ENSOGAG00000005086 transcript:ENSOGAT00000005090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCGPPATFQPHLAGPPGTACHPVAVCQQESLSFVELPTLQPPNPVCLDLFPVASEELRA
PGSRWSLGTPAPLQGLLWPASPGGAETEISTGGGIRPSRAGSWPHCPAAPPPALEGPWSP
QHPQPQRRASHGSEKKSAWRKMRVYQREEVEGSLEAQDVFLEAGQTLQEQTLSTDESRPR
ELSAGTRPSLEGPERRRFSASELMTRLHSSLRLGRSSASRTLIPASGSEAAREGKAFGRE
SRGVEMRVDGVSLLDPVDSSMRPGCWPESRLDTQEESPLGTRSASERRQSRFLLNSVLYQ
EYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLSPSSSFRAQRSARGSTFSLWQ
DIPDVRGSGVLATLSLRDCKLQEAKFELITSEASYIHSLSVAVGHFLGSTELSECLGAQD
KQWLFSKLPEVKSTSERFLQDLEQRLEADVLRFSVCDVVLDHCPAFRRVYLPYVTNQAYQ
ERTYQRLLLENSRFPSILARLEESPVCQRLPLTSFLILPFQRITRLKMLVENILKRTAQG
SEDEDMATKAFNALKELVQECNASVQSMKRTEELIHLSKKIHFEGKIFPLISQARWLVRH
GELVELAPLPAAPPAKLKLSSKAVYLHLFNDCLLLSRRKELGKFAVFVHAKMAELQVRDL
SLKLQGIPGHVFLLQLLHGQRTKHQFLLRARTESEKQRWISALCPSTPQEDEEVISEGED
HPQVQCVRTYKALQPDELTLEKTDILAVRTRTSDGWLEGVRLADGEKGWVPQAYVEEISS
LSARLRNLRENKRITSATSKLGEPPA
Download sequence
Identical sequences H0WRA5
ENSOGAP00000004548 XP_012657053.1.62490 ENSOGAP00000004548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]