SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004556 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004556
Domain Number 1 Region: 108-355
Classification Level Classification E-value
Superfamily Kelch motif 1.57e-40
Family Kelch motif 0.023
Further Details:      
 
Domain Number 2 Region: 45-83
Classification Level Classification E-value
Superfamily F-box domain 0.000000000144
Family F-box domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004556   Gene: ENSOGAG00000005095   Transcript: ENSOGAT00000005098
Sequence length 717
Comment pep:known_by_projection scaffold:OtoGar3:GL873528.1:7767869:7824546:1 gene:ENSOGAG00000005095 transcript:ENSOGAT00000005098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSSDSEDDSFMAVDQEETVLEGTMEQDEEPRPLLEVEETRHNRSMSELPEEVLEYILS
FLSPYQEHKTAALVCKQWYRLIKGVAHQCYHGFMKAVQEGNIQWESRTYPYPGTPITQRF
SHSACYYDANQSMYVFGGCTQSSCNAAFNDLWRLDLNSKEWIRPLASGSYPSPKAGATLV
VYKDLLVLFGGWTRPSPYPLHQPERFFDEIHTYSPSKNWWNCIVTTHGPPPMAGHSSCVI
DDKMIVFGGSLGSRQMSNDVWVLDLEQWAWSKPNISGPSPHPRGGQSQIVIDDATILILG
GCGGPNALFKDAWLLHMHSGPWAWQPLKVENEEHGAPELWCHPACRVGQCVVVFSQAPSG
RAPLSPSLNSRPSPISATPPALVPETREYRSQSPVRSMDEAPCVNGRWGTLRPRAQRQTP
SGSREGSLSPARGDGSPILNGGSLSPGTAAVSGSSLDSPVQAISPSTPSAAEGYDLKMGL
SLASRRGSLPDQKDLRLGSIDLNWDLKSASSSNHMDGMDNRTVGGSMRHPPEQMNGVHTP
PHVASALAGAVSPGALRRSLEAVKAMSSKGPSTSAALSPPLGSSPGSPGSQNLSSGETVP
IPRPGPAQGDGHSLPPIARRLGHHPPQSLNVGKPLYQSMNCKPMQMYVLDIKDTKEKGRV
KWKVFNSSSVVGPPETSLHTVVQGRGELIIFGGLMDKKQNVKYYPKTNALYFVRAKR
Download sequence
Identical sequences H0WRB2
ENSOGAP00000004556 XP_003783920.1.62490 ENSOGAP00000004556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]