SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004567 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004567
Domain Number 1 Region: 53-258
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 6.51e-71
Family Proteasome subunits 0.00000000427
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004567   Gene: ENSOGAG00000005107   Transcript: ENSOGAT00000005109
Sequence length 263
Comment pep:known_by_projection scaffold:OtoGar3:GL873744.1:696496:702656:-1 gene:ENSOGAG00000005107 transcript:ENSOGAT00000005109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALASVLERPLPVNQRGFFGLGGRADLLDLGPKSPSDGLSLVAPSWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYHLEVEQAYDLARRAIYQATYRDAYSGGSVNLYHVRE
DGWIRVSSDNVAELHDKYRGLTP
Download sequence
Identical sequences H0WRC1
ENSOGAP00000004567 XP_003801967.1.62490 ENSOGAP00000004567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]