SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004614 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004614
Domain Number 1 Region: 1472-1720
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.85e-40
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 2 Region: 717-864,898-945
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.18e-31
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 3 Region: 1147-1302,1345-1421
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.63e-31
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 4 Region: 132-277,350-427
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.24e-30
Family Voltage-gated potassium channels 0.018
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000004614
Domain Number - Region: 1727-1774
Classification Level Classification E-value
Superfamily EF-hand 0.0115
Family Calmodulin-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004614   Gene: ENSOGAG00000005154   Transcript: ENSOGAT00000005159
Sequence length 1863
Comment pep:known_by_projection scaffold:OtoGar3:GL873562.1:5909227:6047570:1 gene:ENSOGAG00000005154 transcript:ENSOGAT00000005159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARLLAPPGPDSFKPFTPESLANIERRIAESKLKKPPKADGSHREDDEDSKPKPNSDLE
AGKSLPFIYGDIPQGLVAVPLEDLDPYYLTQKRTFVVLNRGKTLFRFSATPALYILSPFN
LIRRIAIKILIHSLFSMIIMCTILTNCVFMTFSNPPDWSKNVEYTFTGIYTFESLVKIIA
RGFCIDGFTFLRDPWNWLDFSVIMMAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKT
IVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCVVWPINFNESYLENGTKG
FDWEEYINNKTNFYTVAGMLEPLLCGNSSDAGQCPEGYQCMKAGRNPNYGYTSFDTFSWA
FLALFRLMTQDYWENLYQLHCMMPITLRIRNMSPSYMNFFVLVIFVGSFYLVNLILAVVA
MAYEEQNQATLEEAEQKEAEFKAMLEQLKKQQEEAQSSSELSKLSSKSAKERRNRRKKRK
QKELSEGEEKGDPEKFDPYWKEKQQHCFSIPGSPFLSRHNSKSSIFSFRGPGRFRDPGSE
NEFADDEHSTVEESEGRRDSLFIPIRARERRSSYSGYSGYSQGSRSSRIFPSLRRSVKRN
STVDCNGVVSLIGGPGSHIGGRLLPEVKIDKAATDDSQNSFNSVSGVSMDQLASYGRKDR
INSIMSVVTNTLVEELEESQRKCPPCWYKFANTFLIWECHPYWIKLKEIVNLIVMDPFVD
LAITICIVLNTLFMAMEHHPMTPQFEHVLTVGNLVFTGIFTAEMFLKLIAMDPYYYFQEG
WNIFDGFIVSLSLMELGLADVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALG
NLTLVLAIIVFIFAVVGMQLFGKSYKECVCKINQDCELPRWHMHDFFHSFLIVFRVLCGE
WIETMWDCMEVAGQAMCLIVFMMVMVIGNLVVLNLFLALLLSSFSADNLAATDDDGEMNN
LQISVIRIKKGVAWIKVKVHAFMQAHFKQREADEVKPLGKEGQLYCQPHWCNGNGTTSGI
GSSVEKYIIDEDHMSFINNPNLTVRVPIAVGESDFENLNTEDVSSESDPEGSKDKLDDTS
SSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEGCVQRFKCCQVNIEEGLGKSWWILRKT
CFLIVEHNWFETFIIFMILLSSGALVRSRVECDKGLAGNIFMEYSEAAVIIVYVIIMVLK
DGCFSFKYHFPNPWVWLNLYSVDVSLVSLIANALGYSELGAIKSLRTLRALRPLRALSRF
EGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYHYCFNETSEIRFEIEVV
NNKTECEKLMEGNNTEIRWKNVKINFDNVGAGYLALLQVATFKGWMDIMYAAVDSRKPDE
QPKYEDNIYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYN
AMKKLGSKKPQKPIPRPVNKIQGIVFDFVTQQAFDIVIMMLICLNMVTMMVETDTQSKQM
ENILNWINLVFVIFFTCECVLKMFALRHYYFTIGWNIFDFVVVILSIVGMFLADIIEKYF
VSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGM
SNFAYVKHEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLLPILNRPPDCSLDKEHPGS
GFKGDCGNPSVGIFFFVSYIIISFLIVVNMYIAIILENFSVATEESADPLSEDDFETFYE
IWEKFDPDATQFIEYCKLADFADALEHPLRVPKPNTIELIAMDLPMVSGDRIHCLDILFA
FTKRVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHL
ARR
Download sequence
Identical sequences H0WRG0
ENSOGAP00000004614 ENSOGAP00000004614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]