SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004664 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004664
Domain Number 1 Region: 150-466
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.96e-126
Family Transglutaminase core 0.00000000868
Further Details:      
 
Domain Number 2 Region: 6-149
Classification Level Classification E-value
Superfamily E set domains 1.01e-41
Family Transglutaminase N-terminal domain 0.0002
Further Details:      
 
Domain Number 3 Region: 621-719
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.6e-28
Family Transglutaminase, two C-terminal domains 0.00025
Further Details:      
 
Domain Number 4 Region: 508-619
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.56e-25
Family Transglutaminase, two C-terminal domains 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004664   Gene: ENSOGAG00000005213   Transcript: ENSOGAT00000005220
Sequence length 722
Comment pep:known_by_projection scaffold:OtoGar3:GL873569.1:9952427:9977237:-1 gene:ENSOGAG00000005213 transcript:ENSOGAT00000005220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGCLIAELEVALTDFQTSKNNVQHHTEEISSNRLIIRRGQFFTLILHFSNRGFQPGLDNI
IFVTETGSLPDLAKGTRAVFSLADRAGTSPWIASVLTNGATSLEVSLCAPPTAAVGRYLL
KIHIDPFQGSVTAYQLGEFILLFNPWCPDDAVYLDSEPQRQEYVMNDYGFIYQGNKNWIR
PCPWNYGQFEENIVDICLKLLDKSLHSQIDPVTDCALRGSPVYVSRVVCAMINSNDDNGV
LNGNWSENYTDGVNPAEWTGSVAILKQWRATGCQPVRYGQCWVFAAVMCTVMRCLGIPTR
VITNFDSGHDTDGNLIIDEYYDNTGRILENKKKDTIWDYHVWNECWMARKDLPPGYGGWQ
VLDATPQETSNGLYCCGPASVRAIKEGEVDLNYDTPFAFSMVNADCVSWLVYGGKAQKLH
RDTSSVGNLISTKSIQSDERDDITENYKFREGSPQERQAFLKALQKLKSIRSQGSTQAGP
QPSRPTWPSQDHPRSLDTPSLQPSDVIQVSLKFQLLDPPNMGQDIRFVLLARNMSSQFKD
LKVNLSAQSLLHDGSPLSLFWQDTAFITLYPKEEKTYSCTIPYSQYSQYLSTDKLIRLSA
LVEEKSCAEKVLVNKIITLSYPEITINVLGPAIVNQPLSIQVIFANPLSEQVSDCVLTVE
GSGLFKKQQRVLIGVLKPQHRAKITLKTVPFKSGPRQIQANLRSDKFKDIKGYRNVYVDF
GL
Download sequence
Identical sequences H0WRK5
ENSOGAP00000004664 ENSOGAP00000004664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]