SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004674 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004674
Domain Number 1 Region: 173-198,256-463
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-58
Family Voltage-gated potassium channels 0.00061
Further Details:      
 
Domain Number 2 Region: 41-137
Classification Level Classification E-value
Superfamily POZ domain 7.06e-26
Family Tetramerization domain of potassium channels 0.00000525
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004674   Gene: ENSOGAG00000005228   Transcript: ENSOGAT00000005230
Sequence length 530
Comment pep:novel scaffold:OtoGar3:GL873623.1:3866843:3868435:-1 gene:ENSOGAG00000005228 transcript:ENSOGAT00000005230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSEKSLTLAAPGEVRGPEGEQQDAGDFPEAGGGGGCCSSERLVINISGLRFETQLRTLS
LFPDTLLGDPGRRVRFFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFLEE
IRFYQLGDEALAAFREDEGCLPEGGEDEKPLPSQPFQRQVWLLFEYPESSGPARGIAIVS
VLVILISIVIFCLETLPQFRADGRGGSNGDGVSRVSPVSRGSQEEEEDEDDSYTFHPGIS
SGGMGTGGSPSLSTLGGSFFTDPFFLVETLCIVWFTFELLVRFSACPSKPAFFRNIMNII
DLVAIFPYFITLGTELVQQQEQQSASGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHS
KGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDDDSLFPSIPDAFWWAVVT
MTTVGYGDMYPMTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEQEEQGQYTH
VTCGQPTPDLKVTDNGLGKPDFSEAPRERRPSYLPTPHRAFGEKRMLTEV
Download sequence
Identical sequences H0WRL5
XP_003796468.1.62490 ENSOGAP00000004674 ENSOGAP00000004674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]