SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004704 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004704
Domain Number 1 Region: 19-147
Classification Level Classification E-value
Superfamily Lysozyme-like 3.75e-56
Family C-type lysozyme 0.000000528
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004704   Gene: ENSOGAG00000005260   Transcript: ENSOGAT00000005262
Sequence length 148
Comment pep:known_by_projection scaffold:OtoGar3:GL873644.1:728987:735389:-1 gene:ENSOGAG00000005260 transcript:ENSOGAT00000005262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLLLLGLVLLSAPTQGKVYEKCELARTLKRMGMDGYHGISLANWMCLAKWESSYNTRA
INYNAGDRSTDYGIFQINSRYWCNDGKTPRAVNACGISCNALLQDDITQAVACAKRVVRD
PQGIRAWVAWRNHCQNQDLSQYTRGCGV
Download sequence
Identical sequences H0WRP0
XP_003797865.1.62490 ENSOGAP00000004704 ENSOGAP00000004704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]