SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004712 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004712
Domain Number 1 Region: 169-365
Classification Level Classification E-value
Superfamily E set domains 8.4e-77
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000000114
Further Details:      
 
Domain Number 2 Region: 64-185
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.27e-20
Family Voltage-gated potassium channels 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004712   Gene: ENSOGAG00000005272   Transcript: ENSOGAT00000005272
Sequence length 501
Comment pep:known_by_projection scaffold:OtoGar3:GL873617.1:2242200:2384837:1 gene:ENSOGAG00000005272 transcript:ENSOGAT00000005272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQDLQQQLVPKKKRQRFVDKNGRCNVQHGNL
GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY
TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM
FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE
GEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEIVVILE
GIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKE
QEEMLLMSSPLIAPAITNSKDRHNSVECLDGLDDISTKLPTKLQKITGREDFPKKLLRMS
STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGG
AARMEGNLPAKLRKMNSDRFT
Download sequence
Identical sequences H0WRP8
XP_003795994.1.62490 ENSOGAP00000004712 ENSOGAP00000004712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]