SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004716 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004716
Domain Number 1 Region: 275-422
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 5.49e-42
Family Mannose 6-phosphate receptor domain 0.000000467
Further Details:      
 
Domain Number 2 Region: 122-271
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.18e-41
Family Mannose 6-phosphate receptor domain 0.000000175
Further Details:      
 
Domain Number 3 Region: 582-717
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 6.02e-39
Family Mannose 6-phosphate receptor domain 0.00033
Further Details:      
 
Domain Number 4 Region: 1472-1603
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 8.24e-37
Family Mannose 6-phosphate receptor domain 0.000000147
Further Details:      
 
Domain Number 5 Region: 1322-1463
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.66e-36
Family Mannose 6-phosphate receptor domain 0.00052
Further Details:      
 
Domain Number 6 Region: 714-879
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.03e-33
Family Mannose 6-phosphate receptor domain 0.0018
Further Details:      
 
Domain Number 7 Region: 1180-1319
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 5.63e-33
Family Mannose 6-phosphate receptor domain 0.00018
Further Details:      
 
Domain Number 8 Region: 1025-1175
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.31e-31
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 9 Region: 431-573
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.96e-31
Family Mannose 6-phosphate receptor domain 0.0017
Further Details:      
 
Domain Number 10 Region: 1945-2082
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.62e-30
Family Mannose 6-phosphate receptor domain 0.0014
Further Details:      
 
Domain Number 11 Region: 3-114
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.19e-30
Family Mannose 6-phosphate receptor domain 0.00000226
Further Details:      
 
Domain Number 12 Region: 1608-1753
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 5.76e-30
Family Mannose 6-phosphate receptor domain 0.001
Further Details:      
 
Domain Number 13 Region: 2089-2236
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.62e-28
Family Mannose 6-phosphate receptor domain 0.001
Further Details:      
 
Domain Number 14 Region: 889-1034
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.28e-22
Family Mannose 6-phosphate receptor domain 0.0039
Further Details:      
 
Domain Number 15 Region: 1760-1853,1902-1945
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.57e-22
Family Mannose 6-phosphate receptor domain 0.0038
Further Details:      
 
Domain Number 16 Region: 1852-1901
Classification Level Classification E-value
Superfamily Kringle-like 1.83e-16
Family Fibronectin type II module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004716   Gene: ENSOGAG00000005270   Transcript: ENSOGAT00000005276
Sequence length 2453
Comment pep:known_by_projection scaffold:OtoGar3:GL873575.1:7313581:7403847:-1 gene:ENSOGAG00000005270 transcript:ENSOGAT00000005276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSYTWEAVDTQNNILYKINVCGSVNIAQCGASSAVCMHNVKTDTYRSVGDSHLRSATTS
ILEFNTTDNCEPLQANHKIQSSITFLCGKTLGTPEFVTATECVHYFEWRTSAACKKDIFK
ANKEVPCYAFDEKLGKHDLNPLIKLSGGYLVDDSDPDSSLFINVCRNIDLLRDPGSQLRA
CPFGTAACLVRGDQAFDVGQPKEGLKLVGKDRLVLSYVKEEAEKPDFCDGHSPAVTITFV
CPSERREGTIPKLTAKSNCRYEVEWITEYACHRDYLESKTCSLSSEQQDVAIDLRPLSKA
SLSLGSYYDSDGKEYTFHLNICGANETHICNKKDAAVCQIKKSDSTQVKVAGSYQHQTLR
YSDGDLTLIYSGGDECSSGFQRMSVINFECSETADHDGKGSPVFTGEVDCTYFFTWDTKY
ACVKEKEDLLCSATDGRQRYDLSVLARHSEPEQNWEAVDGSLTETEKKHFFINVCHRVLQ
EGKARGCPEEAAVCAVDKNGSKNLGKFVSSPTKEKGNIHLSYSDGDDCGDGKKIRTNILL
VCKPGDLESAPVLRTSGAGGCFYEFEWHTAAACALAKVEGENCTVFDSQAGFSFDLSPLT
KKTGAYKVETKQYDYYINVCGTLSVDSCQPGSGACQISKSDRRTWNLGLSNGKLSYYDGM
IQLNYKDGTPYNNERHTPRSTLITFLCDREAGVGIPEYQEEDNSTYNFRWYTSYACPEEP
LECVVTDPSTLEQYDLSSLARSESGRGGNWFAMDTSGEHVTWRKYYINVCRPLSPVPGCD
RYASACQMKYIKDQDSFAETVSISNLGMAKSGPVIEESGSLLLEYVNGSACTTSDGRLTT
YTTRIHLVCSRGSLNSHPIFSLNWECVVSFLWNTEAACPVRTTTDTDQTCSIRDPNSGFV
FNLNPLNTSQGYIVWGIGKIFVFNICGTMPMCGVIDGKPASGCEAETQTEDLKNLKPERP
VGFEKSLQVSTEGFITLTYKGPLPATRGGTSTFIIRFICNDDIYPGAPKFLHQDIDSGRG
IRNTYFEFETALACVPTPVDCQVTDLAGNEYDLSGLSSVRKPWTAVDTTADGKKRTFYLS
VCTPLSYIPGCHGSAVGSCLVSEDNSWNLGVVQISPQVAANGSLSVVYVNGDKCGTQRFS
TRIMFECAQISGSPTFQLLDDCEYVFVWRTVEACPVVRAEVYNCQVKDPRHGSLYDLKPL
ALSDTIVSAGEYNYYFRVCGQLSSGVCPTSDRSKVVSSCQEKPGPQGFQKVAGLFTQKLT
YVNGLLKINYTGGDTCHKVYQRSTTIFFYCDRSTQKPVFLKETTDCSYLFEWRTPYACPP
FDLTECSFKDAAGNSFDLSSLSQYSDNWEAITSTGSSEHYLINVCKSLSPQPGTAPCPPE
AAACLQGGAQPVNLGRVRDGPQWTDGVIVLKYVDGDVCPDRIRKKSTTIRFTCSESQVNS
RPMFISAVEDCEYTFSWPTAAACPVRSNQHDDCQVTNPSTGHLFDLSSLSGRTGFTAAYS
EKGLVYMSVCGENENCSPGVGACFGQTRISVGKASKRLTYVDQVLQLVYEDGSPCPSKSG
LSYKSVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACERPTECSVRNGSSIIDL
SPLIHRTGGYTAYDESEDDASDTTPDFYINICQPLNPMHGVPCPAGAAVCKVPVKGPPID
IGRVSGPPILNPIAKEVYLNFESNTPCLADKHFNYTSLIAFHCKRGVSMGMPKLLRTSEC
DFVFEWETPVVCPDEVRTEGCSVTDEQLLYSFNLSSLSKDTFKVTRDSRTYSVGICTPAA
GPDGGGCKDGGVCLLSGSKGVSFGRVASMRLDYRHQDEAVILNYMNGDNCPPETEQGDPC
VFPFIFNRKSYDQCVVEGRSKLWCSTTANYDRDHEWGFCRHSNSHRTSTIIFKCDEDEDI
GRPQVFSEVRGCEVTFEWKTKVVCPPKKMECKFIQKHKTYDLRQLSSLTGSWSLDHEGAV
YYINLCQKIYKGPLECSERASICRKSPTGEVQVLGLVHTQKLDVSGDRVIVTYSKGYPCG
DNKNASTVIELTCSMTVGMPAFKRFDIDSCTYYFSWESRAACAVKPQEVHMVNGTIVNPV
DGRSISLGDIYFKLFSASGDMRSNGDNYLYEIQLSTITSSRNPACSGANICQVKPNDQRF
SRKVGTSDQTKYYIQDGDLDVVFASSSKCGKDKTKSVSSTIFFHCDPLVKDGSPEFSHET
ADCQYLFSWYTSAVCPLRMDFDSENSGDSQGHKGLSERSQAVGAVLSLLLVALTGCLLAL
LLYKKERRETVMNRLTNCCRRSSNVSYKYSKVNKEEETDENETEWLMEEIQLPTPRPGKD
GQENGHLTTKSVKAEALSSLRGDDQDSEDEVLTIPEVKVHSGRGTGAENSHLARNAQRKG
PGEWADDRADDRAGLIKGEKVRRGKPKSAQQTATAPAKLVSFHDDSDEDLLHI
Download sequence
Identical sequences H0WRQ2
ENSOGAP00000004716 ENSOGAP00000004716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]