SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004732 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004732
Domain Number 1 Region: 239-344
Classification Level Classification E-value
Superfamily SRCR-like 3.92e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00052
Further Details:      
 
Domain Number 2 Region: 21-128
Classification Level Classification E-value
Superfamily SRCR-like 8.89e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00083
Further Details:      
 
Domain Number 3 Region: 134-240
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004732   Gene: ENSOGAG00000005293   Transcript: ENSOGAT00000005293
Sequence length 344
Comment pep:known_by_projection scaffold:OtoGar3:GL873610.1:2715035:2723070:1 gene:ENSOGAG00000005293 transcript:ENSOGAT00000005293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLFSLILAICTRPGLLGPPPRVRLVKGSHSCEGRVEVEQQGHWGLVCDDGWDMNDVAV
LCQELGCGVAKRAISGNLYKPLPKEDQKILLQNVDCSGTEKTLAQCKKDEDVFGCSLDEA
AGAVCENLESPVFEDVRLADGPGQCQGRVELKHQDEWNAVCLTGWNLQAAKVVCRQLGCG
RAVLTKKHCEESAQGQRPIWPSQMSCSGQEVSLQDCPSRPQGKSNCTFDDQVWVECEDAF
DLRLAGDKPCSGRLEVLHKGVWGSVCDDGWGAREDQVVCKQLGCGKPLSPSPKDRKSYGP
GVGRIWLDDVRCSGKEQSLEYCQHRFWGYHDCTHKEDVAVICSG
Download sequence
Identical sequences H0WRR4
ENSOGAP00000004732 ENSOGAP00000004732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]