SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004785 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004785
Domain Number 1 Region: 334-627
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.7e-43
Family Galactose oxidase, central domain 0.012
Further Details:      
 
Domain Number 2 Region: 777-923
Classification Level Classification E-value
Superfamily C-type lectin-like 8.77e-23
Family C-type lectin domain 0.0037
Further Details:      
 
Domain Number 3 Region: 122-244
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-22
Family Spermadhesin, CUB domain 0.0022
Further Details:      
 
Domain Number 4 Region: 1057-1103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000364
Family Laminin-type module 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000004785
Domain Number - Region: 93-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.001
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 243-280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0103
Family EGF-type module 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004785   Gene: ENSOGAG00000005349   Transcript: ENSOGAT00000005352
Sequence length 1423
Comment pep:known_by_projection scaffold:OtoGar3:GL873544.1:11856663:12025356:-1 gene:ENSOGAG00000005349 transcript:ENSOGAT00000005352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAAAAATEARLKRRTAATAASAGRNGGPRRDWDVTGAGRSGLEARLRLPPLLSPPLRPW
LLLLPPLLLLLPWEAEAAAAAAVVSGSAAAEAKECDRPCVNGGRCNPGTGQCVCPAGWVG
EQCQHCGGRFRLTGSSGFVTDGPGNYKYKTKCTWLIEGQPNRIMRLRFNHFATECSWDHL
YVYDGDSIYAPLVAAFSGLIVPERDGNETVPEVVATSGYALLHFFSDAAYNLTGFNITYN
FDMCPNNCSGRGECKISNTSNTVECECSENWSGEACDIPYCTNNCGFPYRGICNSSDVRG
CSCFSEWQGPGCSIPVPANQSFWTREEYSNLKLPRASHKAVVNGNIMWVVGGYMFNHSDY
NMVLAYDLASKEWLPLNRSVNNVVVRYGHSLALYKDKIYMYGGKIDSTGNVTNELRVFHI
HNESWVLLTPKAKEQYAVVGHSAHIVTLSSGRVVMLVIFGHCPLYGYISNVQEYDLDKNT
WSILQTHGALVQGGYGHSSVYDHKTRALYVHGGYKAFSANKYRLADDLYRYDVDTQMWTI
LKDSRFFRYLHTAVIVSGNMLVFGGNTHNDTSMSHGAKCFSSDFMAYDIACDRWSVLPRP
DLHYDVNRFGHSAVLYNSTMYVFGGFNSLLLSDILVFTSEQCDAHRTEVACLAAGPGVRC
VWDTELSQCISWELTSKEHEEKLRSECFSKRTLDHDRCDQHTDCYSCTANTNDCHWCNDH
CVPMNHSCAEGQISISKYDNCPKDNPMYYCNKKTSCRSCALDQNCQWEPRNQECIALPEN
ICGIGWHLVGNSCLKITTAKESYDNAKLSCRNHNAFLASLTTQKKVEFVLKQLRIMQSSQ
SMSKLTLTPWVGLRKINVSYWCWEDMSPFTNSLIQWMPSEPSDAGFCGFLSEPSTWGLKA
AICINALNGSVCERPANHSAKQCRTPCALRTACGECTSGSSECMWCSNMKQCVDSNAYVA
SFPFGQCMEWYTMSSCPPENCSGYCTCSHCLEQPGCGWCTDPSNTGKGKCIEGSYKGPVK
MPSQAPTGNFYPQPLLNSSMCLEDSRYNWSFIHCPACQCNGHSKCINQSICEKCENLTTG
KHCETCISGFYGDPTNGGKCQPCKCNGHASLCNTNTGKCFCTTKGVKGDECQLCEVENRY
QGNPLKGTCYYTLLIDYQFTFSLSQEDDRYYTAINFVATPDEQNRDLDMFINASKNFNLN
ITWAASFSAGTQAGEEMPVVSKTNIKEYKDSFSNEKFDFRNHPNITFFVYVSNFTWPIKI
QIAFSQHSNFMDLVQFFVTFFSCFLSLLLVAAVVWKIKQSCWASRRREALNHKATQLGFK
PWTSENVTIGTLNRIPQLLFGSSQTVPKPIALEPCFGNKAAVLSVFVRLPRGLGGIPPPG
QSGLAVASALVDISQQMPIVYKEKSGAVRNRKQQPPAQPGTCI
Download sequence
Identical sequences H0WRV7
ENSOGAP00000004785 ENSOGAP00000004785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]