SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004805 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004805
Domain Number 1 Region: 365-448
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 9.6e-20
Family HLH, helix-loop-helix DNA-binding domain 0.00000934
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004805   Gene: ENSOGAG00000005372   Transcript: ENSOGAT00000005374
Sequence length 452
Comment pep:known_by_projection scaffold:OtoGar3:GL873523.1:3370218:3374249:-1 gene:ENSOGAG00000005372 transcript:ENSOGAT00000005374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDFHRVVENPAAATMPLNVSFASRNYDLDYDSVQPYFYCDEEENFYQQQRQSELQPPAPS
EDIWKKFELLPTPPLSPSRRSGLCSPSYVTVASFSSRGDDDGGGGSFSTADQLEMVTELL
GGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAQLVSEKLASYQAARKDSSSPSPAR
GHSGCSTSSLYLQDMSAAASECIDPSVVFPYPLNDSSSPKPCASPDSTTFSSSSSLLSST
ESSPRASPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQPPAKRSESGSPSARGH
SRPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRAKLDSVRVLRQISNNRKCTSPRS
SDTEENDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATTYILSIQ
AEEQKLISEKDLLRKGREQLKHKLEQLRNSCA
Download sequence
Identical sequences H0WRX5
ENSOGAP00000004805 ENSOGAP00000004805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]