SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004823 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004823
Domain Number 1 Region: 391-510
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.54e-47
Family ets domain 0.0000579
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004823   Gene: ENSOGAG00000005391   Transcript: ENSOGAT00000005393
Sequence length 535
Comment pep:known_by_projection scaffold:OtoGar3:GL873579.1:10516131:10574810:1 gene:ENSOGAG00000005391 transcript:ENSOGAT00000005393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IHITGGSLFLQELINAETFQSGIRVVGSTMDGFYDQQVPFMVPGKSRSEECRGRPVIDRK
RKFLDTDLAHDSEELFQDLSQLQEAWLAEAQVPDDEQFVPDFQSDNLVLHAPPPTKIKRE
LHSPSSELSSCSHEQALGANYGEKCLYNYCAYDRKPPSGFKPLTPPSTPLSPTHPNSLFP
PPQATLPTSAPAAGPVQGVGPTPHSLPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSE
QRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIAPAAPPPPQGFKQEYHDPLYDHGL
PGLPGPPAHGFQSPMGIKQEPRDYCVDSEVPNCQSSYMRGGYFSSSHEGFSYEKDPRLYF
DDTCVVPERLEGKVKQEPTMYREGPPYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGME
FKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALF
SMAFPDNQRPFLKAESECHLNEEDTLPLTHFEDNPAYLLDMDRCSSLPYAEGFAY
Download sequence
Identical sequences H0WRZ2
ENSOGAP00000004823 ENSOGAP00000004823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]