SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004944 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004944
Domain Number 1 Region: 124-354,398-447
Classification Level Classification E-value
Superfamily MFS general substrate transporter 7.85e-48
Family Glycerol-3-phosphate transporter 0.082
Further Details:      
 
Domain Number 2 Region: 567-709
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.57e-20
Family Glycerol-3-phosphate transporter 0.052
Further Details:      
 
Domain Number 3 Region: 472-551
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000000000916
Family Pentapeptide repeats 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004944   Gene: ENSOGAG00000005530   Transcript: ENSOGAT00000005533
Sequence length 713
Comment pep:known_by_projection scaffold:OtoGar3:GL873548.1:9322408:9388312:-1 gene:ENSOGAG00000005530 transcript:ENSOGAT00000005533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDGYRNSPNLYWGARDIAGEAARQSRTRGMDDYKYQDNYEGYAPSDGYYRGNESYPEED
AQSDVTEGHDEEDEIYEGEYQGIPHPDEVRAKPTKMAPSRADGLRGQADLMAERMEDEEQ
LAHQYETIMEECGHGRFQWTLFFVLGLALMADGVEVFVVSFALPSAEKDMCLSSAKKGML
GLIVYLGMMAGAFILGGLADKLGRKRVLSMSLAINASFASLSSFVQGYGAFLFCRLISGI
GIGGALPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGFSMGTH
YHYHSWRVFVIVCALPCTVSLVALKFMPESPRFLLEMGKHDEAWMILKKVHDTNMRAKGT
PEKVFTVSNIKTPKQMDEFIEIQSATGTWYQRWLVRFNTIFKQVWDNALYCVMGPYRMNT
LILAVVWFTMALSYYGLTVWFPDMIRYFQDEEYKSKMKVFFDEHVYGATINFTMENQIHQ
RGKLVNDKFTKMYFKHVLFEDTFFDECYFEDVTSTDTYFKNCTIESTIFYNTDLYEHKFI
NCRFINSTFLEQKEGCHLDVEQDNDFLIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIG
GSMLISAVCCFFLFFGNSESAMIGWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGIL
NGLCKFGAILGNTIFASFVGITKVVPILLAAASLVGGGLIALRLPETREQVLM
Download sequence
Identical sequences H0WS93
ENSOGAP00000004944 ENSOGAP00000004944 XP_003788698.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]