SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004947 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004947
Domain Number 1 Region: 136-312
Classification Level Classification E-value
Superfamily Sec7 domain 6.02e-46
Family Sec7 domain 0.0000965
Further Details:      
 
Domain Number 2 Region: 61-139
Classification Level Classification E-value
Superfamily F-box domain 4.84e-16
Family F-box domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004947   Gene: ENSOGAG00000005533   Transcript: ENSOGAT00000005536
Sequence length 319
Comment pep:known_by_projection scaffold:OtoGar3:GL873580.1:8980616:9000389:1 gene:ENSOGAG00000005533 transcript:ENSOGAT00000005536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQGLWRVARNQQLQQESYGEQGCLGREQSRGMAPSSAPHPGHRRQVQGGIDIYHLLKAR
RSKEQEGFINLEMLPPELSFTILSYLNATDLCLASCVWQDLANDELLWQGLCKSTWGHCS
IYNKNPPLGFSFRKLYMQLDEGSLTFNANPDEGVNYFMSKGILDDSPKEIAKFIFCTRTL
NWKKLRIYLDERRDVLDDLVTLHNFRNQFLPNALREFFRHIHAPEERGEYLETLITKFSH
RFCACNPDLMRELGLSPDAVYVLCYSLILLSIDLSSPHVKNKMSKREFIRNTRRAAQNIS
EDFVGHLYDNIYLIGHVAA
Download sequence
Identical sequences H0WS96
ENSOGAP00000004947 XP_012662418.1.62490 ENSOGAP00000004947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]