SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004955 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004955
Domain Number 1 Region: 391-674
Classification Level Classification E-value
Superfamily RNI-like 9.26e-40
Family 28-residue LRR 0.042
Further Details:      
 
Domain Number 2 Region: 164-416
Classification Level Classification E-value
Superfamily RNI-like 1.86e-33
Family Cyclin A/CDK2-associated p19, Skp2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004955   Gene: ENSOGAG00000005535   Transcript: ENSOGAT00000005544
Sequence length 1372
Comment pep:known_by_projection scaffold:OtoGar3:GL873545.1:20841742:21192724:1 gene:ENSOGAG00000005535 transcript:ENSOGAT00000005544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEESSDVPRELIESIKDVIGRKIKIAVKKKVKLEVKGDKVENKVLVLTSCRAFLVTARI
PTKLELTFSYLEIHGVTCSKPAQMVVETEKCSISMKMASPEDVSDVLAHIGTCLRKIFPG
LSPVRIMKKVSMEPSERLASLQALWDSQTVAEQGPCGGFSQMYACVCDWLGFSYREEVQW
DVDTIYLTQDTRELNLQDFSHLDHRDLIPIIAALEYNQWFTKLSSKDLKLSTDVCEQILR
VVSRSNRLEELVLENAGLRTDFAQKLASALAHNPNSGLHTINLAGNPLEDRGISSLSVQF
AKLPKGLKHLNLSKTSLSPKGVNSLSQSLSANPLTASTLIHLDLSGNVLRGDDLSHMYNF
LAQPNAISHLDLSNTECSLDMVCGALLRGCLQYLAVLNLSRTVFSHRKGKEVPPSFKQFF
SSSLALMQINLSGTKLSPEPLKALLLGLACNHSLKGVSLDLSNCELRSGGAQVLEGCIAE
IHNITSLDISDNGLESDLSTLIVWLSKNRSIQHLALGKNFNNMKSKNLTPVLDNLVQMIQ
DEESPLQSLSLADSKLKTEVTIIINALGSNTSLTKVDISGNGMGDMGAKMLAKALQINTK
LRTVIWDKNNITAQGFQDIAVAMEKNYTLRFMPIPMYDASQALKTNPEKTEEALQKIENY
LLRNHETRKYLQEQAYRLQQGIVTSTTQQMIDRICVKVQDHLNSLRNCGGDAIQEDLKSA
ERLMRDAKNSKTLLPNLYHVAGASWAGSSGSYSSPIQETLESMAGEVTRVVDEQLKALLE
SMVDAAENLCPNVMKKAHIRQDLIHASTEKISIPRTFVKNVLLEQSGIDILNKISEVKLT
VASFLSDRIVDEILDALSHCHHKLADHFSRRIRTLPQQESSEIELAEEKPVKRSIITVEE
LTEIERLEDLDTCMMTPKSKRKSIHSRMLRPVSRAFEMEFDLDKALEEVPIHIEDPPFPS
IRQDKRSSGFIFELPSEEGKKLEHFTKLRPKRNKKQQPTQAAVYAANIVSQDGEQNGLMG
RVDEGVDEFFTKKVTKMDSRKWSTKGSDFHELSEGGDEKKKRDSRRSGGFLNLIKSRSKS
ERPPTVLMTEEPSSPKGSVRSPAVDIPRKDTKAAEHNGSSERIEEIKTPDSFEDSHGEEM
GKMDRSDSKSSPQGGRRYGVQVMGSGMLAEMKAKQEKRAAWTQKKLGNDAVSQDSSSPTL
SSMERLDGGGAVPKLHPGLPENRFGLGSPEKNAKAEAKVEGGARSRSSTPTSPKPPLQSP
KPTLAARPVIPQKPRTTSRPEDTPDSPSGPSSPKVALLPPVLKKVPSDKERENQSSPQPS
PRTFPQEVSRRSWGQQAQEYQEQKQRSSSKDGHQGSKSSDSGEEAEKEFIFV
Download sequence
Identical sequences H0WSA2
XP_003788390.1.62490 ENSOGAP00000004955 ENSOGAP00000004955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]