SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004977 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004977
Domain Number 1 Region: 157-420
Classification Level Classification E-value
Superfamily Caspase-like 1.38e-69
Family Caspase catalytic domain 0.000000197
Further Details:      
 
Domain Number 2 Region: 10-85
Classification Level Classification E-value
Superfamily DEATH domain 0.00000247
Family Caspase recruitment domain, CARD 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004977   Gene: ENSOGAG00000005566   Transcript: ENSOGAT00000005569
Sequence length 421
Comment pep:known_by_projection scaffold:OtoGar3:GL873719.1:1034223:1045314:-1 gene:ENSOGAG00000005566 transcript:ENSOGAT00000005569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTAGRSLEEDPVNAVKLMASNMLDGIFDDLMENSVLNTDELRKLGEGVTRIVNSTENLFD
DIKEKTQKASRILTDHFLNTEVQLSLKCLSENEDDQSEESAASSSSSAESRADSEDEETE
QDAGLLAQTSSLALTDPQETQCTQLNKLKLCSRDRFHKMKTKMIDEIYPVMEREGRTRLA
LIICNKEFNYLPNRCGSEIDLLGMQDLLENLGYSVIVKENLTAEEMEKELQQFAARPEHQ
SSDSTFLVFMSHGILQGICGVKHRMQEPDVLHDDTIFQIFNNQNCRSLKDKPKVIIMQAC
RGRGSGMVWVAADLGEAAADTHGHPLLKRCVWSDAITMAHVEKDFIAFKSSTPHNVSWRL
DIGSLFISQLNLRYLATALIHTINFLLPEVQRSFETPNIVTQMPTIERVSMTRYFYLFPG
N
Download sequence
Identical sequences H0WSB8
ENSOGAP00000004977 ENSOGAP00000004977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]