SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005003 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005003
Domain Number 1 Region: 525-616
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 4.84e-41
Family Small-conductance potassium channel 0.00000391
Further Details:      
 
Domain Number 2 Region: 394-566
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.03e-27
Family Voltage-gated potassium channels 0.004
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000005003
Domain Number - Region: 29-110
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00915
Family beta-sandwich domain of Sec23/24 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005003   Gene: ENSOGAG00000005595   Transcript: ENSOGAT00000005599
Sequence length 713
Comment pep:known_by_projection scaffold:OtoGar3:GL873610.1:5260713:5406205:1 gene:ENSOGAG00000005595 transcript:ENSOGAT00000005599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTSGHFHDSGVGDLDEDPKCPCPSSGDEQQQPPPPPAPPAAPQQPPGPSLQPQPPQPQH
QPPHPLSQLAQLQGQPVHPGLLLSSPTAFRGPPSSNSTTILHPSSRQGSQLNLNDHLLGH
SPSSTATSGPGGGSRHRQASPLVHRRDSNPFTEIAMSSCKYSGGVMKPLSRLSASRRNLI
EAEPEGQALQLFSPGNPPEIVISSREDNHAHQTLLHHPNATHNHQHAGTASSTTTFPKAN
KRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGLYSKDSMFSLAL
KCLISLSTLILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIP
GEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGA
LNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMW
LISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFM
MDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRRVKMEQR
KLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIAD
TLRQQQQQLLSAILEARGVSVAVGTTHNPVSSDSPIGVSSTSFPTPYTSSSSC
Download sequence
Identical sequences H0WSE3
ENSOGAP00000005003 ENSOGAP00000005003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]