SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005025 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005025
Domain Number 1 Region: 187-523
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.98e-78
Family Protein kinases, catalytic subunit 0.000000602
Further Details:      
 
Domain Number 2 Region: 33-183
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.87e-38
Family Regulator of G-protein signaling, RGS 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005025   Gene: ENSOGAG00000005619   Transcript: ENSOGAT00000005624
Sequence length 581
Comment pep:known_by_projection scaffold:OtoGar3:GL873717.1:1804501:1865408:1 gene:ENSOGAG00000005619 transcript:ENSOGAT00000005624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMENVLANAMLLKARLTLGGYGKKNGRSKKWREMLKLPLVSQCKELRSSIEKDYCSLCD
KQPIGRLLFRQFCDTKPKLKRCIEFLDAVAEYEVAEEEDQSDFGLSVLNKFFSKECAVLL
PEVTSRMVKECRAQLLKDPSKTVFEELTRVVHKYLSGTPFEEYQESSYFSHFLQWKLLER
QPVTKHTFRHYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGEAMALNEKRIL
EKVHSRFVVSLAYTYETKDTLCLVLTIMNGGDLKFHLYNLGNPGFDEQRAVFYAAEVCCG
LEDLQKERIAYRDLKPENILLDDRDKGHIRISDLGLAVEIPEGHSVRGRVGTIGYMAPEV
INNEHYTFSPDWWGLGCLIYEMIQGHTPFRKLKEKVRREEVDRRVRKDTEEYSEKFSEAT
RSICRMLLTKNPQERLGCKGDGAAGVKQHPVFKDINFKRLEANMLDPPFCPDPKAVYCKD
ILDIGHFSTVRGVYLDTTDNSFYAQFVTGCVSIPWQNEMIESGCFKDINESENDDTFRSD
IEEKQLVRVSKPKKGFFYRLFRRGGCLTPGYSEQDPEPMMR
Download sequence
Identical sequences H0WSG4
ENSOGAP00000005025 ENSOGAP00000005025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]