SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005026 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005026
Domain Number 1 Region: 65-281
Classification Level Classification E-value
Superfamily RNI-like 1.57e-48
Family 28-residue LRR 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005026   Gene: ENSOGAG00000005622   Transcript: ENSOGAT00000005625
Sequence length 334
Comment pep:known_by_projection scaffold:OtoGar3:GL873529.1:9563396:9581719:1 gene:ENSOGAG00000005622 transcript:ENSOGAT00000005625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTENHCTGAVNAVKEVWEERIKKHNEELKREKEFQQKLVRIWEERVSLTKLKEKVTREDG
RVILKIEKEEWKTLPSSLLKLNQLQEWQLHRTGLLKIPEFIGRFQNLIVLDLSRNTISEI
PRGIGLLTKLQELILSYNKIKTVPKELSHCASLEKLELAVNRDICDLPQELGNLLKLTHL
DLSMNHFTTIPSAVLNMPALEWLDMGSNRLEQLPDTIERMQSLHTLWLQRNEITCLPETI
SKMNNLGTLVLSNNKLQDIPVCMEEMVNLRFVNFRDNPLKLEVMLPPSESTDEEEERELF
GLQFMHVYIQESRRRAGMCVEQINSSFHLAFSVS
Download sequence
Identical sequences H0WSG5
ENSOGAP00000005026 ENSOGAP00000005026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]